(data stored in ACNUC1104 zone)

EMBL: CP000509.PE539

CP000509.PE539       Location/Qualifiers
FT   CDS_pept        581228..581422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80089"
FT                   /db_xref="GOA:A1SE54"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE54"
FT                   /protein_id="ABL80089.1"
FT                   /translation="MSADRLAARRVPKEALRDRTGVVIRQARKAQRLTLRDLAAICEVD
FT                   YTTIKAITEAIGKHMAGAA"
     gtgagcgcgg accgcctcgc ggctcggagg gttccgaaag aggctctccg cgaccgcacg        60
     ggagtcgtga tccggcaggc gcggaaggcg cagaggttga ccttgcgcga cctggcggcg       120
     atctgtgagg tggactacac cacgatcaag gcgatcaccg aggccatcgg caagcacatg       180
     gccggtgcgg catga                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page