(data stored in SCRATCH zone)

EMBL: CP000509.PE541

CP000509.PE541       Location/Qualifiers
FT   CDS_pept        complement(582212..582445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80091"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE56"
FT                   /protein_id="ABL80091.1"
FT                   /translation="MPYPQNHPLREVLAEYRNTITNILFEDEMTGDIELDPAEAFAILL
FT                   KSTYFYAFAIEDLMDQADFDPAKVVPRTVDEI"
     atgccgtacc cccagaacca cccgcttcga gaagtgttgg ccgagtatcg gaacacgatc        60
     acgaacatct tgttcgagga cgagatgacg ggcgacatcg agctcgaccc agcggaggcc       120
     ttcgcgatcc tgctgaagag cacctacttc tacgcctttg ccatcgagga cctgatggac       180
     caggcggatt tcgacccggc aaaggtcgta ccgcgcacgg tcgacgagat ctag             234
//

If you have problems or comments...

PBIL Back to PBIL home page