(data stored in ACNUC1104 zone)

EMBL: CP000509.PE543

CP000509.PE543       Location/Qualifiers
FT   CDS_pept        complement(585456..585692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80093"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE58"
FT                   /protein_id="ABL80093.1"
FT                   /translation="MAVTEDMTRVRQIFDEAMAETFDALFKAPDAVAVVAAVAQGDLAI
FT                   VITGSTLHVVSVTPLSPAPAAAADDDYRPGMYL"
     atggccgtga ccgaggacat gacccgcgta cgccagatct tcgatgaggc gatggccgag        60
     acgttcgacg cgctgttcaa ggcgcccgac gccgtggctg tcgtcgccgc ggtggctcag       120
     ggggacctgg cgatcgtgat caccgggagc accctgcacg tggtctcggt gacaccgctc       180
     agcccggcgc cggcggcggc ggcggacgac gactacaggc ccgggatgta tctgtga          237
//

If you have problems or comments...

PBIL Back to PBIL home page