(data stored in ACNUC1104 zone)

EMBL: CP000509.PE544

CP000509.PE544       Location/Qualifiers
FT   CDS_pept        complement(585699..586034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80094"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE59"
FT                   /protein_id="ABL80094.1"
FT                   /translation="MSFEEDRARDRVREAANAGYLSNWAAARERFEQATREWEAAAREY
FT                   RDAYHRIADRNPLLDEFGLTTGEVAPLGARDQAVLDAAEHLEAQAWARRQAAATAFERA
FT                   DDFSHPW"
     atgagcttcg aggaggaccg ggcccgcgac cgggtgcggg aggcggcgaa cgccggctac        60
     ctgagcaact gggccgctgc gcgcgagcgc ttcgagcagg caacgcgcga gtgggaagcg       120
     gccgcccggg agtaccgcga cgcgtaccac cggatcgccg accgcaaccc cctgctcgac       180
     gagttcgggc tgaccaccgg cgaggtcgcg ccgttgggcg cccgcgacca ggcagtgctc       240
     gacgccgccg agcacctgga ggcgcaggcc tgggctcgac gacaggccgc agcgaccgcg       300
     ttcgagcgcg ccgacgactt cagccacccg tggtga                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page