(data stored in ACNUC1104 zone)

EMBL: CP000509.PE547

CP000509.PE547       Location/Qualifiers
FT   CDS_pept        complement(587200..588729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0555"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lxx:Lxx24020 phage-related terminase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80097"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE62"
FT                   /protein_id="ABL80097.1"
FT                   /translation="MRLLDDPDALVQPSFYHCPDYVVTIGPEVADLVQLFGRTANPEQR
FT                   LLLDGSFGMDRRGRLAAFEVFVEAARQNLKTGFFEFRALGKALLLHRPMQIWTAHKESA
FT                   TDQALLDLKQMIEESAELSKRVKRITEGKGGKSIEFTNRCTIVFRPRTGKAGQSMSADD
FT                   VDLDEYFAVEAKHEGSLLPTMSTRPNAQVGAASSAPHLGSHMQRALMARGRMAALGLRI
FT                   EPRLLYAEWSPIRVIGEKPDGSPRFGPPPCAQPKCTHRLGVEGCIADDREVIKLANPSA
FT                   GRSSKPAISWEFIADERRKLCSPEAPEESLDEYFKERLSIGVEEVGLEASIFPTWPGLK
FT                   QAPPAPLEVLALGVACDNDQTVLSLGAACKGHAHTHLAVVDRRAATERKGFAENVARIQ
FT                   RERSCAVLIRGKNFMIDDLIEAGVTLRLVDADERAQSHADLATAIETNALEHGDYPELN
FT                   AAVEVAQWQVLDNRRSLDSRRGEISALESVALALRGATKPNPTVEPFAIWG"
     atgaggctgc ttgacgaccc ggacgccctg gtccagccgt cgttctacca ctgcccggac        60
     tacgtcgtga cgatcggccc cgaggtcgcc gacctggtcc agctgttcgg ccgcaccgcg       120
     aacccggagc agcggcttct gctcgacggc tcgttcggca tggaccgccg cggtcggctc       180
     gccgctttcg aggtcttcgt cgaggccgcg cggcagaacc tgaagaccgg gttcttcgag       240
     ttccgggcgc tcggcaaggc gctgctgctg caccggccga tgcagatctg gaccgcgcac       300
     aaggagtccg cgaccgacca ggcgttgctc gacctcaagc agatgatcga ggagtcggcc       360
     gagctctcca agcgcgtgaa gcggatcact gagggcaagg gcggcaagtc gatcgagttc       420
     accaaccggt gcacgatcgt gttccggcca cggaccggta aggccggcca gtcgatgtcc       480
     gccgacgacg tcgacctgga cgagtacttc gccgtcgagg ccaagcacga gggctcgctg       540
     ctgccgacga tgtccactcg gcccaatgcc caggtgggcg ccgcgtcgtc cgcgccgcac       600
     ctcggcagcc acatgcagcg cgcgttgatg gcccgcggca ggatggccgc cctcggtctg       660
     cgcatcgagc cccggctgct ctacgccgag tggtcgccga tccgggtgat cggggagaag       720
     cccgacggct caccgcggtt cgggccgccg ccgtgtgcgc agccgaagtg cacgcaccgg       780
     ctcggcgtgg agggctgcat cgccgacgac cgcgaggtca tcaagctggc caaccccagc       840
     gccgggcggt cgagcaaacc ggcgatcagc tgggagttca tcgccgacga gcggcgcaag       900
     ctgtgcagcc ccgaggcgcc tgaggagtcc ttggacgagt acttcaagga gcggctgagc       960
     atcggggtcg aggaggttgg cctcgaagcg tcgatcttcc cgacctggcc ggggttgaag      1020
     caggcgccgc cggctccgct cgaggtgctc gccctgggcg tggcgtgcga caacgaccag      1080
     acggtgctct cgctcggagc cgcgtgcaag ggccacgcgc acacgcatct ggctgtcgtg      1140
     gatcgccgcg cggccaccga gcgcaagggg ttcgcggaga acgtcgcgcg gatccagcgc      1200
     gagcgcagtt gcgcggtcct gatccggggt aagaacttca tgatcgacga cctgatcgag      1260
     gccggcgtca cactgcgcct ggtcgacgcc gatgagcgag cacagagcca tgccgacctg      1320
     gccaccgcga tcgagaccaa cgccctcgag cacggcgact accccgagct caacgctgcg      1380
     gtggaggtcg cacagtggca ggtcctcgac aaccgtcgca gcctcgactc ccgccgcggc      1440
     gagatcagcg ctctcgagtc tgtcgcgctc gcgctgcgcg gcgcaacgaa gcccaacccg      1500
     accgtcgaac cgttcgcgat ctggggctga                                       1530
//

If you have problems or comments...

PBIL Back to PBIL home page