(data stored in SCRATCH zone)

EMBL: CP000509.PE550

CP000509.PE550       Location/Qualifiers
FT   CDS_pept        complement(590431..591093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80100"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE65"
FT                   /protein_id="ABL80100.1"
FT                   /translation="MGAGNVKAVLTDWSAHVRDPAFRVLVAIALTTKDDDDPPVFWGGL
FT                   ELLAAALGRRAPLTDADLRAVGRAMGQLRKAGAIVRVQHSAPGKAPRHELRIKPSTPDA
FT                   ARLVNQGSTPDARRPVNNGEHRTRGGYSQDAPRPNTGRPASDRGVLGTTEEGASHPPSV
FT                   STGGRSREVVDVTIVDAALHRFEPVSHRPSRCSICDRAAADPRHATPSIELHEAVNT"
     gtgggcgccg gcaacgtcaa ggcggtgctg actgactggt ccgcgcacgt ccgcgaccca        60
     gcgttccggg tgctcgtcgc gatcgcgctt acgacgaagg acgacgacga cccgcccgtg       120
     ttctggggtg ggctcgagct gctcgcggca gcgctcggtc gaagggcacc gctgaccgac       180
     gcggacctgc gtgcggtcgg tcgcgcgatg ggccagctcc ggaaggccgg cgcgatcgtg       240
     agggttcagc actcggcacc cgggaaggcg ccacgccatg agctccggat caagccctca       300
     acaccggacg cggcgcgact tgtgaatcaa gggtctacgc cggacgcccg gcgtcctgtg       360
     aataacggtg aacacaggac gcgtggtggt tattcacagg acgcgccacg accgaacaca       420
     ggacgccccg cgtccgacag aggagtacta ggaaccactg aggaaggcgc atcgcatccg       480
     ccgtccgtaa gtacaggagg gcgctcacgc gaggtcgtcg acgtgacgat cgtcgacgct       540
     gcactgcacc ggttcgagcc ggtcagccat cgcccgagtc gatgcagcat ctgcgatcgg       600
     gccgcggccg atccgcgcca cgccacgccg tcgatcgaac tccacgaggc ggtgaacacg       660
     tga                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page