(data stored in ACNUC1104 zone)

EMBL: CP000509.PE551

CP000509.PE551       Location/Qualifiers
FT   CDS_pept        complement(591094..591324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80101"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE66"
FT                   /protein_id="ABL80101.1"
FT                   /translation="MSEPRRQGSGPADDVRAQIDRLGRLMQDEGDPFVAAVGAEISEVA
FT                   TMRPRTDGTEFARLAYLALVWALGEIEGRED"
     gtgtctgagc cgcggcgtca aggctccggg ccggcggacg acgtacgtgc tcagatcgac        60
     cgcctcggcc gcctgatgca ggacgaaggc gatccgttcg tcgccgccgt cggggccgag       120
     atctcggaag tggcgaccat gcgccctcgg actgacggca ccgagttcgc ccggctcgcg       180
     tacttggcgc tcgtctgggc tctcggtgag atcgaagggc gtgaggactg a                231
//

If you have problems or comments...

PBIL Back to PBIL home page