(data stored in ACNUC1104 zone)

EMBL: CP000509.PE554

CP000509.PE554       Location/Qualifiers
FT   CDS_pept        591983..592798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80104"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE69"
FT                   /protein_id="ABL80104.1"
FT                   /translation="MTPSTQEEIWFRAGRIIRPKDPVVRDGNVIWAEEYDGKAPRAPGP
FT                   DDLLDRYCRLAIATHEEIAEFVALNGLPEVGGFVMLGEEKAPDWRQRFPDEPGRVPADR
FT                   IREHARGVAAARRVGAALAGRRPGDQADWLDMHRFLNPGKRRLASRPGWLGQELGDWSL
FT                   ERDRFAGLVSDFLASTGVYTGVNWSDYKRLAIVPVSSTFLGAIALLLSREIGAEGRYAC
FT                   SSCGSPVDRRRPPRAGESVYCDRPECKREQQRRNQAAWRAKKAAERGGS"
     atgacgccgt cgactcagga agagatctgg ttccgggccg gccggatcat taggcccaag        60
     gacccagtcg tgcgtgacgg aaacgtgatc tgggcggagg agtacgacgg caaggcgccg       120
     cgagctccgg gccctgatga cctgctcgac aggtactgcc gtctcgctat cgccacgcac       180
     gaggagatcg ctgagttcgt cgcgctcaac ggccttcccg aggtcggagg cttcgtgatg       240
     ctcggagaag agaaggcgcc ggattggcgg caacggttcc cagacgagcc cggccgcgtg       300
     ccggccgatc gaatcaggga gcacgcgagg ggtgtcgccg ctgcgcgcag ggtgggcgca       360
     gccctggccg ggcgacggcc gggcgaccag gccgactggc tcgacatgca ccgattcctg       420
     aaccctggca agcggcgcct ggcgtcccgc ccgggctggc ttggccaaga gctcggcgac       480
     tggtccctag agcgggacag gttcgccggg ctggtctccg acttcctagc gagcaccggg       540
     gtctacaccg gagtcaactg gtccgactac aagcgcctcg cgatcgttcc ggtctcgagc       600
     accttcctcg gcgccatcgc gctgttgctc agccgcgaga taggtgccga gggcagatac       660
     gcctgctcct cctgcgggtc gccggtcgat cgccgccgtc cgccacgcgc gggtgagtcc       720
     gtgtactgcg atcggcccga atgcaagcga gagcagcagc gacgcaacca agcggcatgg       780
     cgggcgaaga aggcggcgga gaggggcggg tcctga                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page