(data stored in ACNUC1104 zone)

EMBL: CP000509.PE557

CP000509.PE557       Location/Qualifiers
FT   CDS_pept        complement(595341..596720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0565"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   sco:SCO5349 integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80107"
FT                   /db_xref="GOA:A1SE72"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE72"
FT                   /protein_id="ABL80107.1"
FT                   /translation="METSFDVRIYAVLPYRGARGTTYAVRWQVQGRRFRRTFTTRKLAD
FT                   AFRAQLKVAAQAGQSFVVDNGLPLSMQEQAPERTWMQHAMAYVDVKWAHASARHRRGIA
FT                   EALTDVTIATMPEAGGRPPVARMRRVLFRWAFNTAARSTSLDDEHAAALAWLTRHSPPL
FT                   VAFSSSATLRQALDRIALRQDGRPAAASTVTRKRATLHNVLEYAVEVEAFPSNPLHRVR
FT                   WRPPRTTEVVDRRVVVNPTQARALLDAVQTASPALTAYFASLYYAGLRPGEAIELRRED
FT                   LQLPMSGWGQILLSRSHQRAGAAWTDTATAGEVRGLKHRGREDTRPVPAHPDLVATLTR
FT                   HLETFPTGAQGHLFAARTGRAGTPLSPPYHSLVSAKTIYRVWAAARRNALTRQQADSVL
FT                   ARRPYDLRHACLSTWLNAGVPPARVAEWAGHSVDVLLRIYANCVEGDDKIALTRISEEL
FT                   Q"
     atggagacca gcttcgacgt acggatctac gcggtgctcc cctaccgggg agcccggggt        60
     accacctatg cagtcaggtg gcaggtgcag ggtcgccggt tccggcgcac cttcacgacc       120
     cggaagctgg cggacgcgtt ccgcgcccag ctcaaggtcg ctgcccaggc cggccagtcc       180
     ttcgttgtcg acaacggcct gccgctctca atgcaggagc aggcgccgga gcgcacctgg       240
     atgcaacacg cgatggccta cgtcgacgtc aagtgggccc acgcctcggc ccgccaccgt       300
     cgtgggatcg ccgaggcgct gacggacgtc acgatcgcga cgatgccgga ggcaggtgga       360
     cgtccgccgg tggctcggat gcgccgcgtg ctgttccggt gggccttcaa caccgccgca       420
     cgctcgacca gtctggatga cgagcatgcc gccgcgctcg cttggctcac gcggcactcg       480
     ccgccactgg tggccttcag cagctccgcg accctgcgtc aggcactgga ccggatcgcc       540
     ctacgccagg acggacgccc ggccgcggct tctaccgtca cccgcaagcg cgccactttg       600
     cacaacgtct tggagtacgc cgtcgaggtt gaagcgttcc ccagcaaccc gctgcatcgg       660
     gtgcggtggc gaccgccgcg caccaccgag gtcgtcgacc ggcgagtcgt ggtcaacccg       720
     acccaggcac gggccttgct cgatgccgtc cagactgcct ccccagcgct caccgcctac       780
     ttcgccagcc tgtactacgc cggtctccga ccgggcgagg ccatcgagtt gcgccgggag       840
     gatctgcaac tccccatgtc ggggtggggg cagatcctgc tgtcccgctc tcatcagcgc       900
     gccggggccg cctggaccga caccgccacc gccggcgagg tacggggact caagcaccgc       960
     ggccgcgagg acacccgacc ggtcccggct cacccggacc tggtcgccac gctgacgcga      1020
     catctcgaga cgttcccgac cggcgctcaa ggccacctct tcgccgcccg cactgggcgc      1080
     gccggcacgc ccctctcacc gccctaccac tcgctggtca gcgcgaagac catctaccgg      1140
     gtctgggcag cggcccgacg caacgcactc acccggcagc aggccgactc cgtgctcgcc      1200
     cgccgaccct acgacctgcg ccacgcctgc ctgtccacct ggctcaacgc cggggtgcca      1260
     ccggcccgcg tcgccgaatg ggccggccac agcgtcgacg tcctcctccg gatctacgcc      1320
     aactgcgtcg agggtgacga caagatcgcc ctcacccgga tcagcgagga gctccagtag      1380
//

If you have problems or comments...

PBIL Back to PBIL home page