(data stored in ACNUC1104 zone)

EMBL: CP000509.PE559

CP000509.PE559       Location/Qualifiers
FT   CDS_pept        complement(597415..598725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80109"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE74"
FT                   /protein_id="ABL80109.1"
FT                   /translation="MYGENGAQMRTELAALLRQHRVMHRLAADSPTERAEVGQQILRYR
FT                   RTLLTWCVQAIRVAQPLTFPNIPLKPADPFRATSDHGAAVSELVRALELARDQAATTAA
FT                   SSTALATPSLNDVVEHWRLAARAAALAEHDTAPDVSVQLTGAQARTIAGDVAAISQALV
FT                   VLDRRYRNTPDWESLAGCDRLGWAALATALDVSLGQPDYSVDQTGWRPRTKPIRGPAKP
FT                   GVLGVLQAEHNLLVRLKSLPNAINLRLIVDSQRLLTSQLIPYAERVDPPLAEQWRARTA
FT                   TYSRIQRELRNVGGRLGNGAGATAEAANAVSRMKALPSGTVIEPRMLGGFQTLFRRIDE
FT                   RISDVLEAGVERGAFVQRVTVPRLASGEGRLVHPVRERFVPVAHPSDLEVVRTIREHLR
FT                   PRPEPAAVSPGASRVDLHAALIHRPPAKGTQFDVPGL"
     atgtacggcg agaacggtgc ccagatgcgc acggagttgg cggcgctcct gcgccagcac        60
     cgggtgatgc accggctcgc cgcagactcg ccgaccgagc gggctgaggt cggacaacag       120
     atcctgcgct accgtcgcac gctcctcacc tggtgcgtgc aagccatccg tgtcgcacag       180
     ccgctgacgt tcccgaacat cccgctgaag ccggcggatc ccttccgcgc gacgagcgat       240
     catggcgcgg cagtgagcga actggtccga gctctcgagc tcgctcgcga tcaggcagcg       300
     acgacggccg cgtccagtac ggcactcgcg acgccgagct tgaacgacgt ggtcgagcac       360
     tggcgcctgg cagcaagggc cgcagccctc gccgagcacg acaccgcgcc cgacgtatcc       420
     gttcaactca cgggagccca agcgcgaaca atcgcaggcg acgtcgcggc gatcagccaa       480
     gcactggtcg tgctcgatcg tcggtaccgg aacacgcccg actgggagtc gctcgccggc       540
     tgcgatcgac tcgggtgggc cgcactcgct actgcgctcg acgtcagcct cgggcagccc       600
     gactacagcg tcgaccagac cggctggcgc ccacggacca agccgatccg cggaccggcc       660
     aagccgggag tcctcggagt gctccaggcc gagcacaacc tcctggtccg gctgaagtcg       720
     cttcccaacg ccatcaactt gcgcctaatc gtcgactctc agcgcctgct cacctcacag       780
     ctcattcctt acgccgaacg ggtcgatccc ccactggccg agcaatggcg agcccgcacc       840
     gcgacgtact cacggatcca gcgcgagctc cgcaacgtcg ggggaagact cggcaacggc       900
     gccggcgcca ccgcagaagc cgcgaacgcg gtcagccgaa tgaaggcgtt gccatccgga       960
     accgtgatcg agccgcggat gctcggtggc ttccagacgc tcttccgccg catcgacgaa      1020
     cgcatcagcg atgtcctcga agccggtgtc gagcgcgggg cattcgttca gcgcgtgacc      1080
     gtgccgcgac tggcgagcgg cgaaggacgg ctggtccacc cagttcgcga gcgcttcgtg      1140
     ccagttgccc acccgagcga cctcgaagtc gtcaggacca tacgtgagca cctgcggcct      1200
     cggccagagc ctgccgcggt gtcgccgggc gcgagccggg tcgatctcca tgccgccctc      1260
     atccaccgtc cgcccgcgaa ggggacgcag ttcgatgtcc caggtcttta g               1311
//

If you have problems or comments...

PBIL Back to PBIL home page