(data stored in ACNUC1104 zone)

EMBL: CP000509.PE56

CP000509.PE56        Location/Qualifiers
FT   CDS_pept        complement(63995..65443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0057"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afm:Afu5g00510 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79606"
FT                   /db_xref="InterPro:IPR021345"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCS1"
FT                   /protein_id="ABL79606.1"
FT                   /translation="MRTASVEFYDGQARKRFDGNRAPWALERTIMSTDFRGGLLGELTL
FT                   ARPGRTARASSFDQTGRNRDNWIVMPGEERTLADLEGPGFITHIWMTQSCRIQPGPSQI
FT                   DPAGVGVPMLEIHNALGVNWEVVDPDYYRKILFKIYWDDQETPSVIAPLGDFFGLMNSL
FT                   SGSYDSLPLSVSAKEPELHTFGGSAAFNSYFRMPFAKRARVVVENQNDIPYLQYFYIDY
FT                   ELSPTALPEDTVYFHAHWRRALPNVGWGPDLQTNSIETTIPNLTGADNYVALETEGRGH
FT                   YVGCTLAVRHFQGSWWGEGDDMIFIDDDTWPPSLHGTGMEDYFGHAWGMQRNAYQFNGT
FT                   IVHEEDVPGFHHSYRFHMVDPIRFEKRIKVTFEHGHGNHLSDDWSSTAYWYQTLPSPVL
FT                   EVPDVDDRLPLRPVNRVIEAPLPELSDEQRTARERADERMRRFVEARDALREERRGEVD
FT                   DWERGNVDQARAIRRSYDAEREGN"
     ttgcgcacgg catcggtcga gttctacgat ggtcaagcgc gcaaacgttt cgacggcaac        60
     cgtgccccgt gggcacttga aaggacgatc atgagtactg acttccgcgg cggcctcctg       120
     ggcgagctga ccttggcccg ccccgggcgc acggcccgcg cttccagctt cgaccagacg       180
     ggacgcaacc gggacaactg gatcgtcatg ccaggcgagg agcgcacgct tgccgacctc       240
     gaggggccgg gcttcatcac gcacatctgg atgacccagt cctgccggat ccaacccggg       300
     ccgagccaga tcgaccccgc gggcgtgggg gttcccatgc tcgagattca caacgcgctc       360
     ggggtgaact gggaggtcgt cgacccggac tactaccgga agatcctgtt caagatctac       420
     tgggacgacc aggagacgcc cagcgtcatc gccccactgg gggacttctt cgggttgatg       480
     aactcgctgt ccggcagcta cgactcactg ccgctctcgg tctcggccaa ggagcccgag       540
     ctccacacct tcgggggcag cgctgcgttc aactcctact tccgcatgcc gttcgcgaag       600
     cgggctcgcg tagtggtcga gaaccagaac gacatcccgt acctccagta cttctacatc       660
     gactacgaac tgtcccccac ggccctgccg gaggacacgg tgtacttcca cgcgcactgg       720
     cggcgtgccc tcccaaacgt cggctggggg cctgacctgc agaccaacag catcgagacc       780
     acgatcccga acctgaccgg tgccgacaac tacgtcgcgc tcgagaccga gggccgtggc       840
     cactacgtcg gttgcaccct cgcggtccgg cacttccagg ggtcctggtg gggcgaaggc       900
     gacgacatga tcttcatcga cgacgacacg tggccgccca gcctgcacgg caccggcatg       960
     gaggactact tcggccacgc gtggggcatg cagcgcaacg cctaccagtt caacggcacg      1020
     atcgtccacg aggaagacgt gcccgggttc caccacagct accggttcca catggtcgac      1080
     cccatccggt tcgagaagcg catcaaggtc accttcgagc acgggcacgg caaccatctc      1140
     tccgatgact ggtcgtcgac cgcgtactgg taccagaccc tcccgtcgcc cgtgctcgag      1200
     gtgccggacg tcgacgaccg gctgcccctg cgaccggtga accgcgtgat cgaggctccg      1260
     ctgcccgaac ttagcgacga acagcgcacc gctcgcgagc gggccgacga gcggatgcgt      1320
     cgcttcgtag aggcacggga cgccttgcgc gaggagcgcc gaggcgaggt ggacgactgg      1380
     gaacgcggca acgtggacca ggcgcgggcc atccggcgtt cctacgacgc ggaacgcgag      1440
     ggcaactga                                                              1449
//

If you have problems or comments...

PBIL Back to PBIL home page