(data stored in ACNUC1104 zone)

EMBL: CP000509.PE561

CP000509.PE561       Location/Qualifiers
FT   CDS_pept        complement(599141..599677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80111"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE76"
FT                   /protein_id="ABL80111.1"
FT                   /translation="MSPYPDEPDDPDGYRSVTELLERPPVPINWNLLDAEQAEIEWHDL
FT                   DEWVKWLKSTFGLPPNIVPPYWHRHDELVWELSALHCHWLSCYHESASPSAPISWMREF
FT                   AEARGRLRDWVSICGTRLDRDRPTRQTTWPGELPADSGGEIEIRDRKKDFADFVREDVL
FT                   RRRRIEAIANQQLIG"
     atgagtccgt acccggacga gcccgacgac cctgacggct accgcagcgt gacggagctc        60
     ctggagcgac cgccggttcc gatcaactgg aacctgctgg acgcggagca ggccgagatc       120
     gagtggcacg acctggacga gtgggtcaag tggctcaaga gcacgttcgg tctcccgccg       180
     aacatcgtgc cgccgtactg gcaccgccac gacgaactcg tctgggagct gtcggcgctg       240
     cactgccact ggctcagctg ctaccacgag tcggcgtcgc cgtcggcacc catcagctgg       300
     atgcgggagt tcgcggaagc tcgcggccgg ctgcgggact gggtgtcgat ctgtggtact       360
     cggctcgacc gcgaccgccc gactaggcag accacctggc cgggcgagct cccggccgac       420
     tccggcggcg agatcgagat ccgcgaccgc aagaaggact tcgccgactt cgtacgcgaa       480
     gacgtcctgc gccgtcgccg gatcgaggcg atcgcgaatc agcaactcat tgggtga          537
//

If you have problems or comments...

PBIL Back to PBIL home page