(data stored in ACNUC1104 zone)

EMBL: CP000509.PE567

CP000509.PE567       Location/Qualifiers
FT   CDS_pept        606498..607802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0576"
FT                   /product="protein of unknown function DUF1486"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; NmrA
FT                   family protein; protein of unknown function DUF1486; KEGG:
FT                   nfa:nfa29880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80117"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE82"
FT                   /protein_id="ABL80117.1"
FT                   /translation="MSQILVIGARGKTGRHVASGLVSRGVSVKAASRNPEEVSGGHGVP
FT                   TRFDWHDSSTWRSALAGIDAVYLVKPESEDVVEIVTEFLHAMGDAGVRRLVLLSECATH
FT                   TRSEDATERRVELAVEATDLEWTILRPSWFMQDIIAEDFFGPMIRDGGIIVMTTGGSAT
FT                   AWIDVRDIAEVAVELLIGGGSIGQAVDLTGPEALTLNELAERITAAAGTPVLGVEETVA
FT                   EAESRMRRDGFDEDTIAYLTRIVESIIEGHTANVTGDVERITGHPPRHFDSFLVDHARD
FT                   LRRTGDLDADNTRPDAAADNEALFRRLVAAWASSDFDTLLDCFADDMVYTDMPFPDAPV
FT                   QGKTAFKRHVTDYNALFARGQVDTELVTVVATDTHVVGELSCRASYVGPGAPAEGVPVH
FT                   WYATLVDTIDDGKVVSEHAYFDPTAFDKAIQRVST"
     atgagtcaga tcctggttat cggcgcgcga ggcaagaccg ggcgacacgt ggcgtccggg        60
     ctcgtctcgc gtggggtgtc agtcaaggca gcctcacgca atccagaaga ggtttccggc       120
     gggcatggcg tcccgactag gttcgactgg cacgacagct cgacctggag gtcagctctc       180
     gccggtatcg atgccgtgta ccttgtgaag cccgagtccg aagacgttgt cgagatcgtg       240
     actgagttcc tgcacgcgat gggggacgcc ggcgtgcgac ggctcgtcct gctttccgag       300
     tgcgcgaccc acactcgctc tgaagacgca acggaacgcc gggtcgagct ggctgtggag       360
     gccacggatc tcgagtggac gattctccgt ccgagctggt tcatgcagga catcatcgcg       420
     gaagacttct tcgggccgat gatccgcgat ggcggcatca tcgtgatgac caccggcggt       480
     tcggcgacgg cctggatcga tgttcgcgac atcgctgagg tagctgtcga actcctgatc       540
     ggcggcggtt ccattggcca ggcggtcgac ctgaccggcc cggaagcact cacgttgaac       600
     gagctcgccg aacgcattac cgccgcggcc ggcacgcccg tgctcggcgt cgaggaaacc       660
     gtggccgaag ccgagagtcg tatgcgccgt gacgggttcg acgaggacac catcgcgtac       720
     ctaacccgga tcgtcgagag catcatcgaa ggacacaccg cgaacgtcac cggtgatgtc       780
     gaacggataa ccgggcaccc acctcgccac ttcgactcct ttctggttga ccatgcccga       840
     gaccttcgtc gtactggtga cctcgacgcc gacaacacgc gaccagacgc cgccgccgac       900
     aacgaggccc tcttcaggcg gctagttgcg gcgtgggcca gcagtgactt cgacacgctg       960
     ctcgactgct tcgcagacga catggtctat acggacatgc ccttccccga cgccccggtc      1020
     cagggtaaaa ccgccttcaa gcgccacgtg accgactaca acgccctgtt cgcccgcgga      1080
     caggtagaca ctgaattggt gacagtcgta gcgaccgaca cgcatgtcgt cggcgagctg      1140
     tcgtgtcgcg cgagctacgt aggccccggc gctccggcgg aaggggtccc ggtccattgg      1200
     tacgccacat tggtcgacac catcgacgac gggaaggttg tctcggagca cgcgtacttc      1260
     gaccccacag ccttcgacaa ggctatccaa cgcgtctcta cttaa                      1305
//

If you have problems or comments...

PBIL Back to PBIL home page