(data stored in SCRATCH zone)

EMBL: CP000509.PE568

CP000509.PE568       Location/Qualifiers
FT   CDS_pept        610474..610818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0578"
FT                   /product="protein of unknown function DUF336"
FT                   /note="PFAM: protein of unknown function DUF336; KEGG:
FT                   mlo:msr9402 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80118"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE83"
FT                   /protein_id="ABL80118.1"
FT                   /translation="MLDSGGHLIVAERSDASPIGRFEIARGKAYGALALGMNSRAIMER
FT                   SEVQPQFVASATAALDGRVIPVPGGVLLDDRNGRLVGAVGVSGDTSDNDESVAMEAIAA
FT                   VGFIPRGAGT"
     gtgctcgata gcggcggcca cctcatagtg gcggagagat cggacgcttc gcccatcggt        60
     cgattcgaga ttgcccgggg taaggcctac ggcgccctgg cgctgggcat gaattcgcgc       120
     gccatcatgg agcgaagcga agtgcagccg cagttcgtgg catcggcgac cgcggcgctg       180
     gacgggcgcg tcatccccgt accgggtggc gtcctgttgg acgaccgcaa tgggcggctc       240
     gtcggcgctg tgggggtatc aggcgacacg tccgacaacg acgaatccgt agcgatggag       300
     gctatcgctg cagtgggctt cataccccgc ggcgcgggga cgtga                       345
//

If you have problems or comments...

PBIL Back to PBIL home page