(data stored in SCRATCH zone)

EMBL: CP000509.PE569

CP000509.PE569       Location/Qualifiers
FT   CDS_pept        complement(611044..613143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0579"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; glucose-inhibited division protein A; KEGG:
FT                   sme:SMa0257 probable methylamine"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80119"
FT                   /db_xref="GOA:A1SE84"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037348"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE84"
FT                   /protein_id="ABL80119.1"
FT                   /translation="MNRVPPAAHHRVLFEPISIGSKTLRNRFFNVAHGTAYGVLRPSTW
FT                   ASYRAVRAEGGWAAVSTEFSSVGPSSDESPLHSSDIWDGEDGRRHKAMVDAVHEHGALA
FT                   SIELHHGGAHAMRRLSREPALSPSGLAGELPPPAGPLGTPKVMTLEDIERVEQSFVDAA
FT                   VRARDVGYDIVDVLAGYGYLFAQFLSAFHNHRTDKYGGSLENRARFWIETLGRVRDAVG
FT                   ADCAVASRMSIQTQGPWGHTLDESVELVRMADPLVDLWDLNVGSVLDWGSDISPSRVIP
FT                   EGHNVELFTRVRSATQKPIVGVSRWTSPDLMAEVVRSGVIDLIGSARQSIADPFFPQKV
FT                   YEGRIEDIRECMGINHCISSLDRGNMACAQNATAGEEYRRGWHPERFEPLERPDVSVLV
FT                   VGAGPAGLEAAIGLARRGADMVHLVDSADQVGGHLRQVVDLPGLREWGRFIDHRKIQID
FT                   KLPNLQLIASTTLSAAEILEYGASHVVVATGARWLDTGLAPGTHTPLPGVDGLEWVFTP
FT                   DQLLARGDRPVSGCRVTVYDAEGSYMGSGLSQLLADEGYKVSVVTPHAQVTAEGDLTLD
FT                   GPAVRRSLHTSGVAMYRNVSLTEVGDGLLRGADEFEEPFLLETDALVLVTMRAPVDDVY
FT                   RQLVSERNTLHESEIEAVLCIGDAQSPRPLAEAMFDGHRLAREFESTDPSVPLPYRRES
FT                   LQFVK"
     ttgaatcgcg tgcccccggc tgctcatcac agggtcctat tcgaacccat ctcaatcggc        60
     tcgaagaccc ttcgaaaccg cttcttcaac gtggcccacg gcaccgccta cggggtactt       120
     cgtccgtcca cgtgggcctc ataccgcgct gttcgcgctg aaggcggctg ggcagcggtg       180
     tcgacagagt tctccagcgt ggggcccagc agcgacgagt cccccctgca ctccagtgac       240
     atctgggacg gggaagacgg acgacggcac aaagctatgg tcgacgccgt ccatgaacac       300
     ggtgcgctcg cgagcatcga actgcatcat ggcggcgctc acgctatgcg aaggctgtcc       360
     cgagagcctg cgctgtcgcc gtccggcctc gccggcgaat tgccaccgcc cgccggacca       420
     cttgggactc cgaaagtcat gaccctcgag gacattgagc gcgtcgagca gtcctttgtt       480
     gacgcggcgg tgcgtgcacg cgacgtgggc tacgacatcg tggacgtgct cgcgggatat       540
     ggatatctct tcgcgcagtt cctgtccgca ttccacaacc accgcaccga caagtatggc       600
     gggtcgttgg agaacagggc caggttctgg atcgagaccc tcggccgagt ccgtgacgcc       660
     gtaggtgccg actgcgcggt cgcgagtcgc atgtcgatcc agacgcaggg tccgtggggt       720
     cacacgctgg acgagagcgt ggagttggtc cggatggctg atccactggt cgacttgtgg       780
     gatctcaatg ttgggtccgt cctggattgg ggtagcgaca tcagcccgtc gagggtcatc       840
     cccgaggggc acaacgtaga gctcttcaca cgcgttcgga gcgccactca gaagcccatc       900
     gtcggggtat cgcgatggac gagtcctgac ctgatggccg aggtagtgcg ctctggagtt       960
     atcgacctca tcggatctgc tcgccagtcg atcgcggatc ccttcttccc ccagaaggtc      1020
     tatgagggtc gcatcgagga catcagggaa tgcatgggta tcaatcactg catcagtagt      1080
     ctcgatcggg gcaacatggc gtgtgctcag aacgccaccg ccggcgagga gtacaggcgt      1140
     ggctggcacc cggagcgctt cgaacctctc gaacgcccag acgtcagcgt cttggtcgtc      1200
     ggcgcaggcc cggcaggttt ggaagcagca atcggcctgg cgaggcgagg tgccgacatg      1260
     gtgcacctcg tcgactctgc cgaccaggtt ggcggccacc tccgtcaagt agtcgaccta      1320
     ccgggacttc gagagtgggg acgcttcatc gatcaccgta agatccagat cgacaagctg      1380
     ccgaacttgc agctcatcgc ctcgaccacc ttaagcgccg ccgagatcct cgaatacggg      1440
     gcatcccacg tagttgtcgc gacgggcgca cgatggttgg acaccgggct cgcgccaggc      1500
     acacacacgc cgctgccagg agtcgacggc ctggaatggg tgttcacgcc tgaccagttg      1560
     ctcgcccgcg gcgaccgacc cgtctcgggt tgtcgcgtga ccgtctacga cgctgagggc      1620
     agttatatgg ggtcgggtct ctctcaactc cttgccgacg aaggctacaa agtctccgtc      1680
     gtgacgccgc acgctcaggt gacagcggaa ggggacctga cgctggacgg gccggcggtt      1740
     cgtaggtctc ttcacaccag cggggtcgcc atgtaccgga acgtgtcatt gacggaggtc      1800
     ggcgacgggc tgctccgagg ggcggatgaa ttcgaggagc cgttcttact tgagacggac      1860
     gctctcgtgc tcgtgacgat gcgggcacca gtcgacgacg tgtatcgcca actcgtcagc      1920
     gaacgcaaca cgcttcacga gtcggaaatc gaggccgttc tttgcatcgg agatgcgcag      1980
     tctccgcgcc cgctggccga ggcgatgttc gatggtcatc gcttggcacg tgagttcgag      2040
     tcaaccgatc cctcggtgcc gctgccgtac aggcgcgagt cgttgcagtt cgtcaagtga      2100
//

If you have problems or comments...

PBIL Back to PBIL home page