(data stored in SCRATCH zone)

EMBL: CP000509.PE570

CP000509.PE570       Location/Qualifiers
FT   CDS_pept        614126..615679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0581"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   rha:RHA1_ro06977 possible transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80120"
FT                   /db_xref="GOA:A1SE85"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE85"
FT                   /protein_id="ABL80120.1"
FT                   /translation="MKSAEEIMKILDAYDLTGSLRDAGELAGCSHHTVKRYVVRRAGAG
FT                   ELDKAAVRPQLIDEYLPKVEEWVERSKGKVRADKAHEKLVALGYTGSERTTRRAVAKVK
FT                   AAYRAGHVRVHRPWVTEPGMWLQYDYGDGPVVDGVKTVLFVAWLAWSRFRVVIALRDKT
FT                   MPSVFAALDQTFRRLGGVPTYVLTDNEKTVTVEHIAGIPVRNSQLVGFAEHYSVVVHTC
FT                   VPADPASKGGTESSVKISKADLVPKDTNLREEYGSFAELEAACEEFCHKVNTRDHRITK
FT                   RPPIEMLAEERTRLHPVAMTPHTVAFGTTRVVPANTPMVMFESGQYSVPHALLGATVWV
FT                   RVHGRGGDEQVVIVHVGQDGPVEVARHHRATPGTPRINDDHFPPQPAGPLDRRPRAKNP
FT                   AESEFLDLGEGARLWLIEAAAAGTGRMRVKMSEALALAKLFDPVEVDWALGHAAVHGRF
FT                   AEADLASILDHHARRPAGGEHRASEDSSLTQGTSAWSRLGQQVGQQVGQQVEADSEVTR
FT                   "
     ttgaagtctg ccgaggagat catgaaaatc ttggatgcct acgacctgac agggtcgttg        60
     cgtgatgccg gggagctggc cggctgctcc caccacaccg tcaagcgcta cgtcgtgcgg       120
     cgtgctggtg ccggtgagct ggacaaggcg gccgtgcggc cgcagctgat cgatgagtac       180
     ctgcccaagg tcgaggagtg ggtcgagcgg tccaagggca aggtccgcgc cgacaaggcc       240
     cacgagaagc tcgtggcgct gggctacacc ggttcggagc gcaccacccg ccgtgcggtc       300
     gcgaaggtca aggctgccta ccgcgcggga catgtgcggg tccaccggcc gtgggtcacc       360
     gagccgggga tgtggctgca gtacgactac ggcgacggtc cggtcgtcga cggggtgaag       420
     accgtgctgt tcgtcgcgtg gttggcgtgg tcgcggttcc gggtggtgat cgcgctgcgt       480
     gacaagacga tgccgtcggt gttcgccgct ctggaccaga cgttccggcg tctgggtggg       540
     gtgccgacct atgtgctgac cgacaacgag aagaccgtca cggtcgagca catcgccggg       600
     atcccggtcc gcaactcaca gctcgtcggg ttcgccgagc actactcggt ggtcgtgcat       660
     acctgtgttc ccgcggaccc ggcgtccaag ggcggcaccg agtcgtcggt gaagatcagc       720
     aaggccgatc tggtccccaa ggacaccaac ctgcgagaag agtacggctc gttcgccgag       780
     ctcgaggcag cctgcgagga gttctgtcac aaggtcaaca cccgcgacca tcggatcacg       840
     aagcggccgc cgatcgagat gctcgccgag gaacggaccc ggctgcaccc ggtggcgatg       900
     acgccgcaca cggtggcgtt cggtaccacc cgggtggtgc cggcgaacac gccgatggtg       960
     atgttcgagt ccggccagta ctcggtcccg cacgccctgc tgggcgccac ggtgtgggtg      1020
     cgggtgcatg gccgcggggg cgacgagcag gtcgtcatcg tccacgtcgg ccaggacggt      1080
     ccggtcgagg ttgcccgcca ccaccgggcc acccccggca caccacggat caacgatgac      1140
     cacttcccgc cgcaaccagc ggggccgctg gatcgccgac cacgcgcgaa gaacccggcg      1200
     gagtcggagt tcctcgacct gggcgagggt gcccggctgt ggctgatcga ggccgctgcg      1260
     gcgggcaccg gtcggatgcg ggtcaagatg tccgaagcgc tcgcgctggc caagttgttc      1320
     gaccccgtcg aggtcgactg ggcactcggc catgccgcgg tccacggccg gttcgccgag      1380
     gccgacctgg cctcgatcct ggaccatcac gcccgccgac ccgcaggcgg tgagcaccgc      1440
     gccagcgagg actcctcgtt gacccagggc accagcgcgt ggtcgcgact gggccagcag      1500
     gtcggccagc aggtcggcca gcaggtcgag gccgacagcg aggtgacccg atga            1554
//

If you have problems or comments...

PBIL Back to PBIL home page