(data stored in ACNUC1104 zone)

EMBL: CP000509.PE571

CP000509.PE571       Location/Qualifiers
FT   CDS_pept        615676..616455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0582"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: rha:RHA1_ro06982 possible
FT                   insertion sequence ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80121"
FT                   /db_xref="GOA:A1SE86"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE86"
FT                   /protein_id="ABL80121.1"
FT                   /translation="MTARTAQAPPLPADLEELLRRLRLPHIRRHAPEVVATAKAQRWEP
FT                   AEVLKALFAEEVAGRERSALATRRAAAGFPTGKTFDAWQPEASSIPAPTQQALRTLEWV
FT                   HRRENLVVCGPSGTGKTFLLEALGQHAVEQGLKVAWFTLEDLGVLLRRHRADDTVTKAI
FT                   ARVLRADVVVVDDIGLLPVAADAAEGLYRLVDAAYEKRSVAISSNLHPSGFDELMPKTL
FT                   ATATVDRLLHHAHVCQTSGDSVRLTQALAGQGVSPLS"
     atgaccgcca ggacagcgca agcgccgccg ctgccagcgg acttggagga gttgctgcgc        60
     cggctgcggc tgcctcacat ccgtcgtcac gcccccgagg tcgttgcgac cgcgaaggcc       120
     caacgctggg aaccggccga ggtcctcaag gccctgttcg ccgaggaggt cgccggccgg       180
     gaacgatccg ccttggccac caggcgtgcc gcggcggggt tcccgacggg gaagaccttc       240
     gacgcctggc agcccgaggc ctcctcgatc ccggcgccga cccagcaggc gctccggacc       300
     ctggaatggg tccaccggcg ggagaacctc gtggtgtgcg ggccgtcggg caccgggaag       360
     acgttcctgc tggaggcact cggacaacat gccgtcgagc aagggttgaa ggtcgcctgg       420
     ttcaccctgg aggacctcgg ggtgctgcta cgccgccacc gtgccgacga caccgtcacc       480
     aaggccatcg cccgggtcct gcgagcagac gtcgtggtgg tcgatgacat cggcctcttg       540
     ccggtggccg ccgacgcagc cgaggggctc taccggctcg tcgacgccgc gtatgagaag       600
     cgctcggtcg cgatcagctc gaacctgcac ccatccgggt ttgacgagct gatgcccaag       660
     acgctggcca cggccaccgt cgacagactg cttcaccacg ctcacgtctg ccagaccagc       720
     ggggactccg tgcggctcac ccaagcgctc gccggccagg gggtgagccc gttgagctga       780
//

If you have problems or comments...

PBIL Back to PBIL home page