(data stored in ACNUC1104 zone)

EMBL: CP000509.PE572

CP000509.PE572       Location/Qualifiers
FT   CDS_pept        complement(618228..618641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0585"
FT                   /product="Monoamine oxidase-like protein"
FT                   /note="KEGG: mxa:MXAN_4930 amine oxidase,
FT                   flavin-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80122"
FT                   /db_xref="GOA:A1SE87"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE87"
FT                   /protein_id="ABL80122.1"
FT                   /translation="MTPPSSGTVAVLGAGLAGLAAASSLVAEGFDVTVFEARDRVGGRV
FT                   WLQSLEAAFGPIVIERGAEFVLHGYSETRGLLQQYGLGLVETGMSYYVREVGDLTDVST
FT                   EDLIAAGRDALRFVRDHAHEGALSAEDGLRGGG"
     atgaccccgc cgtccagtgg caccgttgcg gtcctaggag caggtttggc gggcctcgct        60
     gcggcttcga gcctcgttgc cgaggggttc gatgtcacgg tcttcgaagc acgggaccgc       120
     gtcgggggtc gcgtgtggtt gcagtcgctc gaagctgcgt tcggtccgat cgtcatcgag       180
     cgcggcgccg agttcgtgct tcacggctac tccgagacgc ggggtttgtt gcagcagtac       240
     ggtcttgggc tcgtcgagac cgggatgagc tattacgtcc gcgaggttgg cgacctgacg       300
     gacgtgtcga ccgaagacct catcgcggcc ggccgggatg cgttgcgatt cgtgcgcgat       360
     catgcgcacg agggcgcact ctccgcggaa gacggtctgc gggggggtgg gtga             414
//

If you have problems or comments...

PBIL Back to PBIL home page