(data stored in ACNUC1104 zone)

EMBL: CP000509.PE574

CP000509.PE574       Location/Qualifiers
FT   CDS_pept        620470..620763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80124"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE89"
FT                   /protein_id="ABL80124.1"
FT                   /translation="MVKTALKRAGNAVVVWKSADRCEIHPVQIHTSPRRRRSRKGSLID
FT                   WGEAIGEVEVIEVNVPDLAVFKALHDGIIDVMTERPDCQGKTQVSDCGPGRE"
     ttggtgaaga cagcactcaa gcgggcaggc aacgccgtcg tggtctggaa gtcggcagac        60
     cgctgcgaga ttcaccctgt gcagattcac acttcgccgc ggcgtcgccg ttctcggaag       120
     ggcagtctca tcgactgggg tgaggcgatt ggggaggttg aagtgatcga ggtcaacgtg       180
     ccggatcttg ctgttttcaa ggctctccac gacggaatca tcgacgtcat gaccgagcgc       240
     cctgactgtc aggggaagac ccaagtctcc gactgcggtc ccggcaggga gtag             294
//

If you have problems or comments...

PBIL Back to PBIL home page