(data stored in ACNUC1104 zone)

EMBL: CP000509.PE578

CP000509.PE578       Location/Qualifiers
FT   CDS_pept        624278..625204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0591"
FT                   /product="cyclase family protein"
FT                   /note="PFAM: cyclase family protein; KEGG: pfl:PFL_4035
FT                   hypothetical polyketide cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80128"
FT                   /db_xref="GOA:A1SE93"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE93"
FT                   /protein_id="ABL80128.1"
FT                   /translation="MDRAGIKVAASPWGPDDQLGALNHLSREGSAAILARVDGTRSYDL
FT                   SIDYFVGMPSFQAAGDPSYQLFMSHTPAGTVVDNMNGVGEAGNRHVCYSGDVVFMYTHT
FT                   GTHIDSLSHFGVDGHIYNGFSVEDNLGSRGWTKGGAEVIPPIITRGVLIDVAKSHQVDC
FT                   LPDSYAITVEDCQKVLNDAGITLQPGDVALIRTGRMGFWPDGSKVLGNPPGLSLEAAKW
FT                   LTRQGISAIAADQECVEVGPSQHEDNWLPGHCHFLAEAGVPMIELVNLEELSRDGVDEF
FT                   CLIAAPIRLRGASGAPLRPIALPLRDN"
     atggatcggg ccggcatcaa ggttgccgcc agcccgtggg gacccgatga tcagctcggg        60
     gcgctcaatc acctcagccg cgaaggttcc gccgccatcc tggcgcgggt cgacggaacc       120
     cggagctacg atctcagcat cgattacttc gtcggcatgc cgagcttcca agccgctggc       180
     gaccccagtt atcagctgtt catgagccac acccccgctg gaactgtcgt cgacaacatg       240
     aacggagtcg gagaggccgg caatcggcat gtctgctact ccggtgatgt cgtcttcatg       300
     tacacccaca ctgggacgca catcgactcc ctgagccact tcggcgtgga cgggcacatc       360
     tacaacggct tctcggtcga ggacaatctc ggcagtcgcg gatggaccaa gggcggggca       420
     gaggtcatcc cgcccatcat cacccgcggc gtgttgatcg atgtcgccaa gagccaccaa       480
     gtcgactgcc tgccggattc gtacgccatc accgtcgagg actgccagaa ggtgctcaat       540
     gatgcgggca tcaccctgca gccgggcgac gtcgcgctga tccggactgg acgtatgggc       600
     ttctggcccg acgggtccaa ggtgctcgga aatccgcctg gacttagcct cgaggccgcc       660
     aagtggctca cccgccaggg aatctcggcg atcgctgctg atcaggagtg tgtcgaggtc       720
     ggcccgtccc agcacgagga caactggctc ccagggcact gccacttcct tgcagaggcc       780
     ggtgtcccga tgatcgaact ggtcaacctg gaggaactgt cgcgcgacgg cgtcgacgaa       840
     ttctgtctga tcgccgcacc catccgtctg cgcggcgcaa gcggagcacc gctccgaccc       900
     atcgcgttgc cgctgcgtga caactga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page