(data stored in ACNUC1104 zone)

EMBL: CP000509.PE579

CP000509.PE579       Location/Qualifiers
FT   CDS_pept        625236..626420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0592"
FT                   /product="monooxygenase, FAD-binding protein"
FT                   /note="PFAM: monooxygenase, FAD-binding; KEGG:
FT                   bur:Bcep18194_A4962 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80129"
FT                   /db_xref="GOA:A1SE94"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE94"
FT                   /protein_id="ABL80129.1"
FT                   /translation="MSMPKVGVVGGSIAGLTAANLLRDAGCEVDVYERSDTLLSGFGTG
FT                   IVVQPELVRYLLERTSTALEDISVPSNEMRYFDAASGRSAGQVKAGWRFTAYNAVYQKL
FT                   LDAFGTERYHLGKELVLVTPGAETATATFADGAQVTADLLVCADGGGSVARSQLLGRKP
FT                   DYAGYVTWRGMVDQSDVSTETWDFFQDAFTYGLLPDGHIIAYPISQVSSEGEVTGDTRL
FT                   NFQWYWNVEAGEALDELMTANDGNRRPVSVHFPALPASSLEEFRSRATSQLAPNFRELI
FT                   TGAPQPFVTIVADADVPRMAFDRLALIGDAAFTPRPHAAAGAAKAAADAWALADRLVEA
FT                   SGDVQEALAAWEPERLAVGEAYLAKVRAMAAALQHGGEFPPGAAEFRFGLPRPA"
     atgagcatgc cgaaggtcgg tgtcgtcggc ggttcgatcg cgggtctgac ggcggcgaat        60
     ctactccgcg acgctggctg cgaggtggat gtctacgagc ggagcgacac gctgctctcc       120
     ggtttcggca ccggaatcgt agtccagccc gagttggtcc gctacctgct ggagcgcacc       180
     tcgaccgcgc tggaagacat cagtgtcccg agtaacgaga tgcgctactt cgatgctgct       240
     tccggacgga gtgcaggcca ggtcaaggcg gggtggcgct tcacggccta caatgccgtc       300
     taccagaagt tgctggacgc tttcgggaca gagcggtacc acctcggcaa ggaactcgtc       360
     ctcgttaccc cgggagcgga gaccgctacg gccaccttcg ccgatggcgc ccaggtcacc       420
     gctgatctcc tcgtctgtgc ggatggtggc ggctctgtgg cgagatcgca gttgctgggc       480
     aggaagcccg actacgcggg gtatgtcacc tggcgcggga tggtggacca aagcgacgtc       540
     tcgacggaga catgggactt cttccaggat gcctttacgt acggccttct ccccgacggc       600
     cacatcatcg cgtatcccat aagtcaggtt tcctccgagg gtgaggtcac gggcgacacc       660
     cggctcaact tccagtggta ttggaacgtc gaagcaggag aggccctcga cgagctcatg       720
     acggcgaacg acggaaatcg acgacccgtc tccgtgcact tcccggcgct gccggcgtcc       780
     agcctcgaag agttccgcag cagagcgacc agccagttgg cgcccaactt ccgtgaactg       840
     atcaccggag ctccgcagcc gttcgtcact atcgtcgccg acgccgatgt ccctcggatg       900
     gcattcgacc gactcgccct gatcggggat gcggcattca ctccccgacc gcatgctgcg       960
     gcgggagccg ccaaagcggc agccgatgcc tgggcgctcg ccgaccggct cgtcgaggct      1020
     tccggtgacg tccaggaggc cttggcggcg tgggaacccg aacggctggc cgtgggggag      1080
     gcgtacttgg cgaaggtgcg cgcgatggcc gctgccctgc agcacggggg ggagttcccc      1140
     cctggggcgg cagagttccg gttcggtcta cccagacccg cgtga                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page