(data stored in SCRATCH zone)

EMBL: CP000509.PE58

CP000509.PE58        Location/Qualifiers
FT   CDS_pept        66676..67995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0059"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1; KEGG: oih:OB0774 sugar ABC transporter sugar-binding
FT                   protein; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79608"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCS3"
FT                   /protein_id="ABL79608.1"
FT                   /translation="MIGRHLVSRRRRRIAAAALAVSSLLALAACSSASDSNNADGKTTI
FT                   TLSMQNPDVKTADPATWAIVEAFEKANPDIKVEVSGQAVAEHLQSLSIAAQSDTLPDVF
FT                   WVYKATAEDMLEAGKLMDLKPTLDELGITENLPESTVANFTAGDQIYGVPYQGLLTGLW
FT                   VNKKILADNGLEMPSTFDDLVNVAQELSSKDVVTISNGANQSSFSVWSFLVWLDRFGFE
FT                   DKISGMLDGSESYDNPDFVRMYKHIAELRDAGAFASNVSTQTYQQAVDQFLQGKAAMLD
FT                   AGVWASSAIQDSPVAADTVFWNGATFDDGVGDQNIVMNVASAPLVVDHKVADDQDKLDA
FT                   VKAFLDFYYGDEAQQLLVDNGQPPVTNYEPQIDATKQSVLKSALDVATDPSLSSPQSQP
FT                   DLLVSTAVASAMYDSIYGVIQNQLSPEEAVALVQKALDAE"
     atgattggtc gacacctcgt cagtcggcgc cggcgccgga tcgccgccgc ggcgctggca        60
     gtctcgtcgc tcctcgccct cgcggcatgc agcagcgcga gcgactccaa caacgcggac       120
     ggcaagacga cgatcacgtt gtccatgcag aaccccgacg tgaagacggc cgacccagct       180
     acgtgggcca tcgtcgaggc gttcgagaag gccaatcccg acatcaaggt cgaggtcagt       240
     ggccaggccg tagccgagca cctccagagc ctctccatcg ccgcgcagag tgacacgctc       300
     ccggacgtgt tctgggtgta caaggcgacc gccgaagaca tgctcgaggc cggcaagctg       360
     atggacctca aaccgacctt ggacgagctg gggatcacgg agaacctgcc ggagagcacc       420
     gtcgcgaact tcacggccgg cgaccagatc tacggcgttc cctaccaggg gctcctcacc       480
     ggtctgtggg tcaacaagaa gatcctggcc gacaacgggc tcgagatgcc gagcacattc       540
     gacgacctcg tcaacgtcgc tcaggagctg agtagcaagg acgtcgtcac catctctaac       600
     ggcgcgaacc agtcgtcgtt cagcgtctgg tccttcctgg tctggctgga ccggttcggt       660
     ttcgaggaca agatcagcgg catgctcgat ggatcggaga gctacgacaa ccctgacttc       720
     gtgcgtatgt acaagcacat cgccgaactc cgcgacgccg gtgctttcgc ctccaacgtc       780
     tccacgcaga cctaccagca ggctgtggac cagttcctcc agggcaaggc cgcgatgctc       840
     gacgccgggg tctgggcatc gagcgccatc caggactccc ctgtggcagc ggacacggtg       900
     ttctggaacg gcgccacctt cgacgacggt gtcggtgatc agaacatcgt catgaacgtg       960
     gcatccgcgc cgctcgtcgt ggaccacaag gtcgcagatg accaggacaa gctcgacgca      1020
     gtcaaggcgt tcctggactt ctactacggt gacgaggcgc agcaactcct cgttgacaac      1080
     ggccagccgc ctgtgacgaa ctacgagccg cagatcgacg ccaccaagca gagtgtgctg      1140
     aagtcggcct tggatgtcgc caccgacccg tctctgagca gcccgcagtc tcagcccgac      1200
     ctgctggtgt cgacggccgt ggcgagcgcg atgtacgaca gcatctacgg cgtgatccag      1260
     aaccagctct cccccgagga ggccgtggcg ctggtgcaga aggcgctcga cgccgagtga      1320
//

If you have problems or comments...

PBIL Back to PBIL home page