(data stored in ACNUC1104 zone)

EMBL: CP000509.PE581

CP000509.PE581       Location/Qualifiers
FT   CDS_pept        627274..628125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0594"
FT                   /product="molybdopterin dehydrogenase, FAD-binding protein"
FT                   /note="PFAM: molybdopterin dehydrogenase, FAD-binding; CO
FT                   dehydrogenase flavoprotein domain protein; KEGG:
FT                   rpb:RPB_3113 molybdopterin dehydrogenase, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80131"
FT                   /db_xref="GOA:A1SE96"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE96"
FT                   /protein_id="ABL80131.1"
FT                   /translation="MKPPKFRYVAPRSLDDAVEHLASDPDAKVLAGGQSLMPLLAMRLA
FT                   APSILVDLQHVSGLDDIEDQGTSLLIGARVTHREIERSAMVAERLPILSSAVVHIAHPQ
FT                   IRSRGTFGGSTAHADPSGEWPTILLSLGATMRTVSPRGRRTIEADDFFVGPFTSTLAED
FT                   EILTHVSVPTTRTAWSFQEAAVKKGDYGLALVAATGTARDGVLLDPRVTVGAAVGSVRR
FT                   VAEVERLLTETPLTEGLADEAAVTAAASIDPISDIHGNSEYRRKLVASLVRRAVIELMN
FT                   GA"
     gtgaaaccac ccaagttccg ttatgtcgca cccaggtcgc tcgacgacgc tgtcgagcat        60
     ctggcgtccg atccggacgc gaaggtgctg gcgggtggtc agagcctgat gccgctcctc       120
     gccatgcggc tggcagctcc ctcgatcctg gtcgacctgc agcatgtgtc tggcctcgat       180
     gacatcgaag accaaggcac atctctgctg atcggggcgc gtgtgacgca ccgagagata       240
     gagcgttcgg ccatggtggc cgagcgtctg ccgatcctgt cctcggcggt cgtccacatc       300
     gctcatccgc aaatccgatc tcgcggaact ttcggcggca gcacagcaca cgccgacccg       360
     tctggtgagt ggccgaccat cctgctgtcc ttaggcgcaa cgatgcgcac ggtcagtccc       420
     cgcgggcgga ggacgatcga ggccgacgac ttctttgtcg ggcctttcac ctcgaccctc       480
     gccgaagacg agatcctgac ccacgtctcg gtacccacca cgcgcactgc atggtcgttc       540
     caagaagctg ccgtcaagaa gggcgattac gggctcgccc ttgtggctgc caccggtacc       600
     gctcgcgatg gggtgcttct ggacccgaga gtcacagtcg gtgctgctgt cgggtcggta       660
     cggagggttg cggaggtcga gcgtctcttg actgagacgc cactgaccga gggcctggca       720
     gatgaggcgg ccgtgacggc agccgcttcg atcgacccga tctcggatat tcacggcaac       780
     agcgagtatc gccggaagct ggtggcctca ctcgtacgac gtgccgtgat cgaactcatg       840
     aacggagcct ga                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page