(data stored in ACNUC1104 zone)

EMBL: CP000509.PE582

CP000509.PE582       Location/Qualifiers
FT   CDS_pept        628127..628633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0595"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: rxy:Rxyl_1873 (2Fe-2S)-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80132"
FT                   /db_xref="GOA:A1SE97"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE97"
FT                   /protein_id="ABL80132.1"
FT                   /translation="MSTTPEERLDVSMTINGSRYRATVEARRTLADFIREDAQLPGTKL
FT                   GCEHGVCGACTVLLDDLPARSCLTLAVQAEGRQIRTVESLADGQELNHLQRAFREQHGL
FT                   QCGFCTAGFLMTATALLEENATPTREEIVETMSGSLCRCTGYQTIISAIEQAAAEGQSD
FT                   TEDDQ"
     gtgtccacga cccccgaaga gcgtttggac gtctcgatga cgatcaacgg gagccgctac        60
     cgcgctacgg ttgaggcacg ccggacgctg gccgacttca tccgtgagga tgcgcagctt       120
     ccaggcacta agcttggctg cgagcacggt gtgtgcggag catgcacggt actgctcgac       180
     gatctgccgg cgcgttcctg cctcaccctc gcggtgcagg cggaaggccg tcagatccgg       240
     accgttgaga gccttgccga tggccaggaa ctgaaccacc tccaacgtgc gttccgcgag       300
     cagcacggcc ttcagtgtgg attctgcacg gctggcttcc tgatgacggc gactgcgttg       360
     ctcgaggaga acgcgacccc gacacgggag gagatcgtag agacgatgtc gggttcgcta       420
     tgtcgatgca cgggatacca gaccatcatc tctgccatcg aacaagcggc ggccgagggt       480
     cagagcgaca cggaggacga ccagtga                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page