(data stored in ACNUC1104 zone)

EMBL: CP000509.PE583

CP000509.PE583       Location/Qualifiers
FT   CDS_pept        628630..631035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0596"
FT                   /product="xanthine dehydrogenase, molybdenum binding
FT                   subunit apoprotein"
FT                   /EC_number="1.17.1.4"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase,
FT                   a/b hammerhead; aldehyde oxidase and xanthine
FT                   dehydrogenase, molybdopterin binding; KEGG: rxy:Rxyl_1872
FT                   carbon-monoxide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80133"
FT                   /db_xref="GOA:A1SE98"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE98"
FT                   /protein_id="ABL80133.1"
FT                   /translation="MKKLDSHQHMKTPVVAARSVGTRVLRSEDPRLLTGRGEFIADIDL
FT                   PRQLHVAFIRSPVAHARITNLDLSAIRDADGVALAWSGKDVAPFCEGLVGEMAVEGCFP
FT                   TTMPLLAGDEVVYVGEPVAVVVADSRYAAEDACELIDWDFDELPAVTNVDAAAGGGPVA
FT                   NPQLPDNIGLNGGASFGDVSGAFEQAHQVVEGRFYTCRVSAAPMETRGVIADYEWASKA
FT                   LRLWSNTQMPHYLKYMLTAYLGFPEQSVEVITPDTGGGFGLKAHVYPEEMLLPLIAREV
FT                   GRPVKWIEDRRENLIAGAHAHEQYVDIAYALDADGKITGVRTHALGDGGAYHLPPWSMA
FT                   VEPWCAAVMTPTGIYDVPAVEYTYKAAATNKTPVGAYRGVGYMAGTFARECLADDAARA
FT                   LRMSPFDFRRHNVVREFPWTNPQGIVYQEGSWLQTIDALEEMVDYPAFLRRQTELRKEG
FT                   RYIGLGLSCFVESSGESTATSLEHGLGDVYHDTATVRLNPNGTANVTIGLSAQGQGLAT
FT                   TMAQMAADTLGIKVEDVSVQTARSTSHAYGSGTLGSRGAVVAGGAVSRAADVVREKVRQ
FT                   VAAHMLEASTDDIELVDGLASIKGISDASLSIADVATAIYFDLDSWPEDFEPTLEATQA
FT                   YDPSQAMFSNGGHAIMVELDAETGFVRFEKIFSVEDCGTVINPNIVEGQIRGGVIQGIG
FT                   ASVFEELAYDESGQILTTTFLDYGLPTMDVAPPFEINHLETPSSHSASGVKGMGESGLI
FT                   AAPAAVLNAVNDALSPFGVVLRDLPLTPEKVLGAMSGAKVATGLAERS"
     gtgaagaagc tcgacagtca ccagcacatg aagacgccgg tcgtcgctgc tcggtcggtc        60
     gggacccgag tgctgcggtc tgaagacccg cggttgctca ccggccgagg tgagttcatc       120
     gccgatatcg acctcccgcg ccagctccac gtggctttca tacgaagtcc tgttgcacac       180
     gcacgaatca ctaatctcga cttgtccgca atccgcgacg cggacggcgt ggcactggcg       240
     tggtccggca aggacgtcgc ccccttctgc gagggcctcg tcggcgagat ggcggttgaa       300
     ggctgctttc cgaccacgat gccgctgctc gcgggagatg aagtcgtcta cgtcggtgag       360
     cctgtcgccg tggtcgtggc tgactcgcgc tacgcggcag aggacgcttg tgaactgatc       420
     gattgggact tcgacgagct gcctgccgtc accaacgtgg acgcagccgc cggtggcggt       480
     ccagtcgcga acccgcagct gcccgataac atcggactca acggtggcgc gagcttcggt       540
     gacgtttcag gagccttcga acaggcccac caggtcgtcg agggtcggtt ctacacctgc       600
     cgtgtctcgg cggctcctat ggagacgcgc ggcgtgatcg ccgactacga atgggcgtcg       660
     aaggcgctac gtctgtggtc gaacacccag atgccgcact atctgaagta catgctgacg       720
     gcgtacctcg gtttcccgga gcaaagcgtc gaagtcatca ctcccgacac cggcggtggg       780
     ttcggcttga aggcgcacgt ctatcccgaa gagatgttgc tgccactcat cgccagggaa       840
     gtcggccggc ctgtcaagtg gatcgaagac cgtcgagaga acctcatcgc cggcgcacac       900
     gcgcatgagc agtacgttga catcgcgtac gcgctcgatg ccgacggcaa gatcacagga       960
     gtccgtacac acgcgctcgg tgacggcggg gcgtatcacc tgccaccatg gtcgatggcc      1020
     gtggagccgt ggtgtgccgc agtgatgacc cccaccggca tctacgacgt accggctgtg      1080
     gagtacacct acaaggccgc ggccaccaac aagacgcccg tcggcgccta ccgcggggtg      1140
     ggctacatgg ccgggacatt cgctcgtgag tgcctcgccg acgatgccgc gcgtgcactg      1200
     cgcatgtcgc ccttcgactt ccgtcgacac aatgtcgttc gcgagttccc gtggaccaat      1260
     cctcagggca ttgtttacca ggagggaagc tggctgcaga caatcgacgc actcgaggag      1320
     atggtcgact acccggcctt tctgcgtcgg cagaccgagc tgcgcaagga ggggcgctac      1380
     atcgggctgg gcctcagctg cttcgtcgag agcagcggcg agagtacggc gaccagcctc      1440
     gagcacggac tcggcgacgt ttaccatgac accgccacag tccggctgaa ccccaatggc      1500
     accgccaacg tgacgatcgg tctgtcggcg cagggccaag gactcgccac gaccatggcc      1560
     cagatggcag ccgacacctt gggcatcaag gtggaggacg tcagcgtcca gacagcgcgg      1620
     tcgacctctc acgcctacgg ctcaggcacc ctcggtagcc gcggcgcagt cgttgcaggt      1680
     ggagccgtgt cacgagcagc agacgtcgtc agagagaagg tgcggcaggt agccgcccac      1740
     atgctcgaag catcgaccga tgacatcgag ctggtagacg gtctcgcttc gatcaagggc      1800
     atctcggacg cctcgttgtc catcgccgac gttgccaccg caatctattt cgacctcgac      1860
     tcgtggccag aggacttcga gccaaccctc gaagccaccc aggcctacga tccttcccag      1920
     gcgatgttca gcaacggcgg ccacgcgatc atggtggaac tagatgccga gaccggcttc      1980
     gtgcgcttcg agaagatctt ttcagtcgaa gactgcggca cggtcatcaa ccccaacatc      2040
     gtagagggac agatccgcgg cggagtcata caaggcatcg gtgcatccgt attcgaggaa      2100
     ctagcctatg acgagtctgg ccagattctc actaccactt tcctcgacta cggactgccg      2160
     acaatggacg tcgccccgcc gttcgagatc aaccacctcg agacgccctc ctcgcactcc      2220
     gcctcgggcg tgaaggggat gggagagtcg ggcctcatcg cggctcccgc tgcggttctg      2280
     aacgccgtca acgacgccct ttcaccattc ggcgtggtgt tgcgcgacct gccactgacg      2340
     cctgagaagg tgcttggtgc catgtctgga gcgaaggtag cgaccggttt ggcagagcgg      2400
     tcgtga                                                                 2406
//

If you have problems or comments...

PBIL Back to PBIL home page