(data stored in SCRATCH zone)

EMBL: CP000509.PE588

CP000509.PE588       Location/Qualifiers
FT   CDS_pept        637847..638242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0603"
FT                   /product="integrase, catalytic region"
FT                   /note="KEGG: mmc:Mmcs_3178 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80138"
FT                   /db_xref="GOA:A1SEA3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEA3"
FT                   /protein_id="ABL80138.1"
FT                   /translation="MKSRIAVAALDNAVARRGAEGVDVAGCLLHTDRGSQFRSRKLVHQ
FT                   LNRHQMVGSMGRVGAAGDNAAMESFFSLLQKNVLDRRVWNTREELRIAIVTWIERTYHR
FT                   RRRQAALGRLTPVEYELIMKPAATQAA"
     atgaagtccc ggatcgcggt cgccgcgctc gacaacgcgg ttgcccgccg tggtgctgag        60
     ggcgtggatg tggccggctg cctgctgcac accgaccgtg ggtcgcagtt caggtccagg       120
     aagctggtcc accaactcaa ccggcaccag atggtcggct ccatgggccg agtcggcgcg       180
     gccggcgaca acgcggcgat ggagtccttc ttctcgctgc tgcagaagaa cgtgctggac       240
     cgccgcgtct ggaacacccg cgaggagctc cggatcgcga tcgtgacctg gatcgaacgg       300
     acctatcacc gccgccgacg gcaagccgct ctcgggcggt tgaccccggt cgaatacgag       360
     ttgatcatga agcccgccgc cacccaggcg gcctaa                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page