(data stored in ACNUC1104 zone)

EMBL: CP000509.PE59

CP000509.PE59        Location/Qualifiers
FT   CDS_pept        68116..68985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0060"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: oih:OB0775 sugar ABC
FT                   transporter permease; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79609"
FT                   /db_xref="GOA:A1SCS4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCS4"
FT                   /protein_id="ABL79609.1"
FT                   /translation="MIWISSRWKIALMLAPALILFTAFFVYPVGYAIAYSFTDSAGFGA
FT                   AKFVGLDNYLALKDDPFFWQSMRNTIAILVVSVALLIPASFGLALLLRRRIRGGGALRA
FT                   LVFGPAIIAPILVGLIWVFILDPKIGLLNRALEPLGVEPIQWIGGNTLTPYAISLVFIW
FT                   SSVGFAMTIFYAGLQLLPGDVMEAAQLDGAGSWQQLRFVTIPMMRETFAIVAILLITNV
FT                   FKIFELVYMLTGGGPVHRSETLVSYMYFVTFTNQRYGSGMAIAVVIFVLGALTSLAYLA
FT                   AARRRSLA"
     atgatctgga tcagctcccg ctggaagatc gcgttgatgc tcgcgccggc gctcatcctc        60
     ttcaccgcgt tcttcgtcta ccccgtgggc tacgcgatcg cctacagctt cactgactcg       120
     gccggcttcg gagccgcgaa gttcgtcggt ctcgacaact acctggcgct gaaggacgac       180
     ccgttcttct ggcagtccat gcggaacacc atcgccatcc tcgtggtcag cgtcgcgctc       240
     ctcatcccgg catccttcgg actcgcactc ctcctccgcc ggcgcatcag aggtggcggt       300
     gcgttgcgcg ccctggtatt cgggccagcg atcatcgcgc cgatcctggt cggcctgatc       360
     tgggtcttca tcctcgaccc gaagatcggg ctgctcaacc gtgctctcga gccgctgggc       420
     gtcgagccca ttcagtggat cggcgggaac accctgaccc cctacgcgat ctccttggtc       480
     ttcatctgga gcagcgtcgg cttcgcgatg acgatcttct acgccgggct gcaactattg       540
     cccggggatg tcatggaggc tgcccagctc gatggggcgg gctcctggca gcagctgcgg       600
     ttcgtgacga tcccgatgat gagagagacc ttcgccatcg tggccatctt gttgatcacg       660
     aacgtcttca agatctttga gctggtctac atgctcaccg gcggcggtcc ggtgcaccgg       720
     tcggagacgc tggtgagcta catgtacttc gtcaccttta ccaaccagcg ctacggatcc       780
     gggatggcga tcgccgtcgt gatcttcgtg cttggggcgc tcacgtccct ggcctacctc       840
     gcggccgcgc ggcgacggag cctcgcatga                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page