(data stored in SCRATCH zone)

EMBL: CP000509.PE590

CP000509.PE590       Location/Qualifiers
FT   CDS_pept        complement(641063..641557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0606"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: gka:GKP18 carbon monoxide dehydrogenase small chain"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80140"
FT                   /db_xref="GOA:A1SEA5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEA5"
FT                   /protein_id="ABL80140.1"
FT                   /translation="MKTRVTVNGEGYERDVEPRMLLSDFLRHELGLTGTNVGCEHGVCG
FT                   SCTVLLDGEPVRSCTMLAVQCDSRRLTTVEGLACDEKLHGLQDAFSACHGLQCGFCTPG
FT                   MLMTLLPIYNEARRLNDDEIREAISGNLCRCTGYQQIVEAARKALGEAADMADPCVESR
FT                   A"
     atgaagactc gtgtgaccgt aaacggtgaa ggttatgagc gtgacgtcga gccacgcatg        60
     cttctatcgg acttcttgcg gcacgagctg ggactgaccg gcaccaacgt cggttgtgag       120
     cacggggtgt gcggcagctg caccgtgctt ctggatggcg agcccgtgcg gtcctgcacc       180
     atgcttgcgg tgcaatgcga cagccggcga ctgaccaccg tcgaaggcct tgcctgcgac       240
     gaaaagctgc acgggctcca agatgcattc tccgcttgcc acggcctcca atgcggcttc       300
     tgcacgcctg ggatgctgat gaccctgctg ccgatttaca acgaggcgcg tcgactcaac       360
     gacgacgaaa tccgcgaggc aatctccggc aatctgtgtc gctgcactgg gtaccagcag       420
     atcgtggagg cagcccggaa ggcgctcggc gaggccgccg acatggccga cccctgcgtc       480
     gaatctcgag catga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page