(data stored in ACNUC1104 zone)

EMBL: CP000509.PE591

CP000509.PE591       Location/Qualifiers
FT   CDS_pept        complement(641554..642441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0607"
FT                   /product="molybdopterin dehydrogenase, FAD-binding protein"
FT                   /note="PFAM: molybdopterin dehydrogenase, FAD-binding; CO
FT                   dehydrogenase flavoprotein domain protein; KEGG:
FT                   rpb:RPB_3113 molybdopterin dehydrogenase, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80141"
FT                   /db_xref="GOA:A1SEA6"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEA6"
FT                   /protein_id="ABL80141.1"
FT                   /translation="MKPPPFEYVVATSVDHAIELVCSDEDAKFIAGGQSLIPLLSLRFA
FT                   SPTLLVDVSRLTELRDVRRVGEVLRIGALTRHAEIQRLTIFRQDAPLLSTAAGWVAHSQ
FT                   VRNRGTFGGAIAHSDSAAEFPAVLLATGATIVARSRDGERRIPCQDFFGSHFQTALNHG
FT                   ELLTGVEVPAHDASTKWGFSEFARRKGDYAIGGAAVSVRLDEQGRCTRVRAGLIAAGPG
FT                   PTSAKGLDEVLVDRIVDESAVSDAVARAERYLSPESNVHGTKEYRRAVVAESLRRALRQ
FT                   AFDLDRAGTERKSA"
     gtgaagccac cgcctttcga gtacgtggtc gccacatcag tggaccacgc gatcgaactt        60
     gtctgctccg atgaggacgc gaagttcatc gccggcgggc agagcctcat cccgctgctc       120
     agcttgcggt ttgcgagtcc cacgctgttg gtagatgtct cccgactcac cgagcttcgc       180
     gacgtgcgtc gagtaggtga ggtgctgcgt atcggagcgc tgactcggca cgcagagatc       240
     caaaggctga ccatattcag acaggacgct ccgctactct caacggctgc aggctgggtc       300
     gcccactcac aggtgcgcaa tcgagggacg ttcggtggag cgattgccca cagtgacagc       360
     gctgccgagt tcccggcggt gctcctcgcg actggagcca ccatcgtcgc ccgatctcgc       420
     gacggggaac gacgcatccc gtgccaagat ttcttcggct cccactttca gactgccctc       480
     aaccatggcg aactcctgac aggtgtcgag gtccctgcac acgatgcttc caccaagtgg       540
     ggattctcgg agttcgcgcg ccgtaaaggt gactacgcca tcggcggggc agcagtcagt       600
     gtccgcctcg acgaacaggg acgctgcaca cgggtgcgcg cgggtctgat tgcggcgggc       660
     cctggaccca cctcggccaa gggcctcgat gaggttctgg tcgaccgaat agtcgacgag       720
     tcggccgtgt ccgatgcggt tgcccgcgca gagaggtatc tcagtccgga aagcaacgtt       780
     cacgggacga aggagtatcg gcgcgctgtc gtcgcggagt cactacgtcg agctctgcgc       840
     caagcgttcg atctggaccg cgccggaacc gagaggaaat ccgcatga                    888
//

If you have problems or comments...

PBIL Back to PBIL home page