(data stored in SCRATCH zone)

EMBL: CP000509.PE592

CP000509.PE592       Location/Qualifiers
FT   CDS_pept        complement(642623..643873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0608"
FT                   /product="transcriptional regulator, CdaR family"
FT                   /note="KEGG: rha:RHA1_ro03774 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80142"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEA7"
FT                   /protein_id="ABL80142.1"
FT                   /translation="MTIESDLQVVANAVRARIPELVSAIERTSAQEVPEIYEKDDPVYK
FT                   EAERSSVLSALTSIVEGLAGGRRPPDRPSDAALQEARIAAQAGIDLHSLLRTYRVGQSI
FT                   LWDAILEETLHVVDSDERRMAVLKQASDYQYGWNNKVMESVIAAYQAEHNAYFFRSQDR
FT                   KRRAVVSDILRGIPADVQQLGYSLRAEHLAVVAWGRSPEANIRALAVSLDARHLTVSGT
FT                   SGTYLGWLGSSSLKRVLVERPEAARAMRETHLALGEVAHGIDGFRLSHRQAWQAYRVGK
FT                   LRAAGLVNYADVALEALMLKDRQAVQDFVSRELGPLHDEEDPRGELLKSTLRAYFRSGQ
FT                   NAASTAQAIHVHERTVAYRLRSIESRLGVTIGARRDELAAALRLADLLGQVSSADLRDL
FT                   DAQADAGLGPDPEAAAQ"
     atgacgatcg agtccgacct gcaggtcgtg gcgaacgcgg tccgggcgcg gatccctgaa        60
     ctcgtctcgg cgatcgaacg gacttccgca caagaggttc ctgagatcta cgagaaggac       120
     gacccggtat acaaggaagc cgaacgctcc agtgtcctgt ctgcactcac gagcatcgtc       180
     gagggcttgg ccggtggacg ccggccaccc gaccgtcctt ccgatgctgc actccaggaa       240
     gctcggattg cggcccaggc tggcatcgat ctgcactctt tgttgcgcac gtatcgggtg       300
     ggtcagtcga tcttgtggga cgcgatcctg gaggagacct tgcatgtggt cgactcggac       360
     gagcggcgca tggccgtcct aaagcaggcc tcggactacc agtacgggtg gaacaacaag       420
     gtgatggagt ccgtcatcgc cgcctatcaa gccgaacaca atgcctactt cttcaggagt       480
     caggaccgga agcgacgtgc ggtcgtcagt gacatcctgc gagggatacc ggccgacgtt       540
     cagcaactcg gttacagcct gcgtgcggag cacctggctg tcgtcgcatg gggacgctcg       600
     cctgaggcca acattcgggc gctagccgtc agtttggacg cgaggcacct gaccgtgagc       660
     ggcacctctg ggacgtacct gggctggtta ggctcgtcat cgttgaagcg agtactagtc       720
     gagcggccgg aggctgcccg ggcgatgcgc gagacccatc ttgctctggg cgaggtggcg       780
     cacgggatcg atggcttccg gttgagtcac cgtcaggcgt ggcaggcata ccgagtaggc       840
     aagctacgag ccgcgggcct cgttaactac gccgatgtcg cactagaggc actgatgctc       900
     aaggaccgtc aagccgtcca agactttgtg tcgcgtgagc taggtcccct gcatgacgag       960
     gaagatccgc gtggtgagtt gttgaagtcc accttgcggg cctatttcag gtccggacag      1020
     aatgcggcct ctacggcaca ggccattcac gtccacgagc gtacggtggc ttaccgcctg      1080
     cgctcgatcg agtcccgact cggggtgacc atcggcgctc gtcgggacga gctggccgcg      1140
     gcacttcgcc tcgctgacct cctaggccag gtctcaagtg cggacctccg cgatcttgat      1200
     gcgcaggcgg acgccggctt gggccccgac cccgaggctg ccgctcagta a               1251
//

If you have problems or comments...

PBIL Back to PBIL home page