(data stored in ACNUC1104 zone)

EMBL: CP000509.PE593

CP000509.PE593       Location/Qualifiers
FT   CDS_pept        complement(643944..644687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0609"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80143"
FT                   /db_xref="GOA:A1SEA8"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEA8"
FT                   /protein_id="ABL80143.1"
FT                   /translation="MTTGIDHGAEHPGDPFQNPALVNTTDGVITVWSDIGCPWASLALQ
FT                   TLRSRVLQRDVDVAIDHRAFPLELFNKRGTPKGIIDVEVTAIAGLVPALGWQPWTAPDW
FT                   QYVVSTVPAMAAVQAAKALSVGGLRASDELDHALRQAFYIHGRSISVHSEILAAAAGCP
FT                   SLYLPALESALEQGKGYAEVFTHWHTAAALPVQGSPHIFVKDRYAEHNPGVQYHWTARP
FT                   GEGFPRFDRYDESWADLVVDAVVAP"
     gtgacgaccg gaatcgacca cggtgccgag catcctggcg accccttcca gaacccagcg        60
     ctggtcaaca ccacggatgg cgtcatcacc gtctggtccg acatcggttg tccgtgggcg       120
     agtcttgccc tgcagactct gcgttcccga gtgctgcagc gagacgttga cgttgccatc       180
     gaccaccgcg cctttccgct ggagctcttc aacaagcgcg gcacgccgaa gggcatcatc       240
     gatgtcgagg tgactgccat cgccggactg gtgccggctc tcggttggca gccttggact       300
     gctcccgatt ggcaatacgt ggtctccacc gtgccagcca tggccgccgt tcaggctgcg       360
     aaggcgctca gcgtcggtgg cctacgcgcc agtgacgaac tagaccatgc tctacgtcag       420
     gcgttttaca tccacggccg gtcgatcagt gtgcactccg agatccttgc ggctgctgca       480
     gggtgtcctt cgctgtactt gcccgctctc gaatcggctc ttgagcaggg gaagggttac       540
     gcggaggtat tcacgcactg gcacaccgcg gcggcgctgc cggtgcaagg cagtcctcac       600
     atcttcgtca aggaccgcta cgctgaacac aaccccgggg tgcaatacca ctggacggcg       660
     cgcccgggag agggatttcc gcgcttcgat cggtacgacg aatcctgggc ggacttggtg       720
     gtagacgctg tcgtggcccc gtga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page