(data stored in ACNUC1104 zone)

EMBL: CP000509.PE594

CP000509.PE594       Location/Qualifiers
FT   CDS_pept        complement(644690..645766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0610"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   fal:FRAAL2526 putative ribose transport system permease
FT                   protein; putative membrane protein; TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80144"
FT                   /db_xref="GOA:A1SEA9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEA9"
FT                   /protein_id="ABL80144.1"
FT                   /translation="MSHTQDTTDAPVASPDAETLPAPTGVAEAEQKRKAARARTGKARF
FT                   VDFLEAYALLVLLVVIALFFCFWPETSSTFPTVANMRILLASQAVIGVISLGLLLPLLC
FT                   QEFDLSVGNIAGLAAIVVAAYVSSEGNVLAAVVLALTIGLAIGAVNALIVTRLHVNGVI
FT                   ATLGMSTILGGIVLQRTGGLAPASDIPQSLTNFGTGLVAGVPIIFITLLVIAGITYFVL
FT                   NHTSLGRQIYAVGSNMEAAKLVGLRTDGLRAVTFAAGGLLCGLGGLLYVSRAGGASPNV
FT                   GMTFTLPAFAAAFLSAASVRPGRFNVWGTIIAVYFLAVLNNGLSLAGVDPYVNDYVNGG
FT                   ALIAGVALATVLYRRRTT"
     atgagtcaca cgcaagacac caccgacgcg cccgtcgcgt caccggacgc cgagacgttg        60
     ccggctccta caggcgtcgc cgaagcggag cagaagcgca aggctgcgcg agcccgcact       120
     ggcaaggcac gcttcgtgga cttccttgag gcctatgctc tcctggtcct cctggtcgtg       180
     attgccctgt tcttctgctt ctggccggag acgtcatcca cgtttcccac cgtagccaac       240
     atgcgcatcc tgcttgccag ccaggctgtc attggcgtga tctcgctcgg actgctgctc       300
     ccgctcctct gccaagagtt cgacctctcc gtcggcaaca tcgcgggcct cgccgccatc       360
     gtggtggcgg catacgtctc atccgaaggc aatgtgctgg ctgcggtagt cctcgcgctg       420
     accatcgggc ttgcgatcgg tgcggtcaac gctctgatcg tcacccggct gcatgtcaac       480
     ggagtcattg cgaccttggg tatgtccacg atcctggggg gcatcgtcct ccagcgcacc       540
     ggcggcctcg cgcctgcgag cgacatcccc cagtctctca ccaacttcgg aacgggactc       600
     gtggccggcg ttccgatcat cttcatcacc ctcctcgtga tcgcgggtat cacctacttc       660
     gtgctcaatc acacttctct gggtcgccag atctacgctg tgggctccaa catggaagct       720
     gcgaagcttg ttggcctccg cactgatggt ctccgcgcgg tgacgttcgc cgccgggggg       780
     cttctctgcg gattgggtgg tctcctgtat gtctcccgcg cgggcggtgc ctcgcccaac       840
     gtcggaatga ccttcacgct gccggcattc gcagcggcgt tcttgagtgc cgcgtcggtt       900
     cgtccagggc gtttcaacgt ctggggcacg atcatcgctg tctacttcct cgccgtactg       960
     aacaatgggc tgagcctggc cggggttgat ccctacgtga acgactatgt gaacggtggc      1020
     gctcttatcg ccggggtcgc gttggccacc gtgctgtatc gccgacggac gacctga         1077
//

If you have problems or comments...

PBIL Back to PBIL home page