(data stored in ACNUC1104 zone)

EMBL: CP000509.PE6

CP000509.PE6         Location/Qualifiers
FT   CDS_pept        6391..8526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0006"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: pac:PPA0009 DNA gyrase subunit B; TIGRFAM: DNA
FT                   gyrase, B subunit; PFAM: DNA gyrase, subunit B domain
FT                   protein; ATP-binding region, ATPase domain protein domain
FT                   protein; TOPRIM domain protein; DNA topoisomerase, type
FT                   IIA, subunit B, region 2 domain protein; SMART: DNA
FT                   topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79556"
FT                   /db_xref="GOA:A1SCM1"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCM1"
FT                   /protein_id="ABL79556.1"
FT                   /translation="MSDETPIENPAEGGSGTAAAEATDRRPNGVDYDASAIQVLEGLEA
FT                   VRKRPGMYIGSTGERGLHHLIWEIVDNAVDEALAGYCDRIVLTLLADGGIRVEDNGRGI
FT                   PTGTAPGQELPALTLALTVLHAGGKFGGGGYKVSGGLHGVGVSVVNALSTRLVAEVKNR
FT                   GHLWRQSFSAGVPDGELEQVRPVEPDEGTGTTITYWASPDIFETTTHSLETITSRIREY
FT                   AFLNKGLEIVVRDERPAAAEIVDAVEDDTVDPDHRGGIDDAGHDAIKRGEGGALEQIFK
FT                   YDRGLIDYVEHLNRRKTAANPTVIAFEAETPESVENHMSLEVAMQWNTSFSESVHTFAN
FT                   TINTHEGGTHEEGFRAALTSLVNNWGFEWGLMKKPEDRVSGDDIREGLTAIISIKLGEP
FT                   QFEGQTKTKLGNTEAKGFVQRLVNDQLGAWLEQNPAEGRDIVRKAQAAASARIAARKAR
FT                   DLARSRKGLLGGGGLPGKLSDCQSTNPAECEVFIVEGDSAGGSARQGRDPRIQAILPIR
FT                   GKILNVEKARIDKVLSNQEVQSIISALGTGIQDEFDIEKLRYHKVVLMADADVDGHHIN
FT                   TLLLTLLFRFMKPLIEGGYVYMAQPPLYRLRWNKPHEHEFVYSDAERDALLRAGQEAGK
FT                   KLPKENPVQRYKGLGEMNAKELWETTMDPEQRLMLQVTLDDAAHADEIFSILMGEDVEQ
FT                   RRSFIQRNAKDVRFLDI"
     gtgtcggacg agaccccgat cgagaacccg gcggagggcg gctccggcac agccgccgca        60
     gaggccaccg accgtcgccc caacggggtc gactacgacg cctcggccat ccaggtcctc       120
     gagggcctcg aagccgttcg caagcgtccc gggatgtaca tcggctcgac cggtgagcgc       180
     ggcctgcacc acctgatctg ggagatcgtg gacaacgcgg tcgacgaggc gctcgcgggc       240
     tactgcgacc gcatcgtgct gacgctcctg gccgacggcg gcatccgcgt cgaggacaac       300
     gggcgcggca tcccgaccgg caccgcgccg ggacaggagc tgccggcgct cacgctggcc       360
     ctgaccgtgc tccacgccgg cggcaagttc ggcggcggcg gctacaaggt ctccggcggc       420
     ctgcacggcg tcggcgtctc ggtggtgaac gccctctcca cccgcctggt cgccgaggtc       480
     aagaaccgcg gccacctgtg gcggcagagc ttctcggccg gtgtgcccga cggcgagctc       540
     gagcaggtcc ggccggtgga gcccgacgag ggcaccggca ccacgatcac gtactgggcc       600
     tcccccgaca tcttcgagac cacgacccac tcgctggaga ccatcacctc gcggatccgc       660
     gagtacgcct tcctcaacaa gggcctggag atcgtcgtac gcgacgagcg cccggcggcc       720
     gccgagatcg tcgacgcggt cgaggacgac accgtcgacc cggatcaccg cggggggatc       780
     gacgacgccg ggcacgacgc gatcaagcgt ggggagggcg gcgcgctcga gcagatcttc       840
     aagtacgacc gcggcctgat cgactatgtc gagcacctca accgccgcaa gaccgccgcg       900
     aacccgacgg tgatcgcgtt cgaggcggag acgccggagt cggtcgagaa ccacatgagc       960
     ctcgaggtgg cgatgcagtg gaacacctcc ttctcggagt cggtccacac cttcgccaac      1020
     accatcaaca cccacgaggg cggcacccac gaggaggggt tccgcgccgc gctcacctcc      1080
     ctggtcaaca actgggggtt cgagtggggg ctgatgaaga agccggagga ccgggtctcc      1140
     ggtgacgaca tccgcgaggg cctgaccgcg atcatctcga tcaagctcgg tgaaccccag      1200
     ttcgagggcc agaccaagac caagctcggc aacaccgagg ccaagggctt cgtgcagcga      1260
     ctggtcaacg accagctcgg cgcctggctc gagcagaacc cggccgaggg ccgcgacatc      1320
     gtccgcaagg cccaggccgc ggcgtccgcc cggatcgcgg cgcgcaaggc ccgcgacctg      1380
     gctcgctccc gcaagggtct gctcggtggc ggtggcctgc ccggcaagct ctcggactgc      1440
     cagtcgacca accccgccga gtgcgaggtg ttcatcgtcg agggtgactc cgccggtggg      1500
     tcggcccgcc agggccggga cccccggatc caggcgatcc tcccgatccg cggcaagatc      1560
     ctcaacgtcg agaaggcccg catcgacaag gtcctgagca accaggaggt ccagtcgatc      1620
     atctcggcgc tgggcaccgg catccaggac gagttcgaca tcgagaagct gcgctaccac      1680
     aaggtggtgc tgatggccga cgccgacgtc gacggccacc acatcaacac cctgctgctc      1740
     accttgctgt tccggttcat gaagccgctg atcgaaggcg gctacgtcta catggcccag      1800
     ccgccgctgt accggctgcg ctggaacaag ccgcacgagc acgagttcgt ctactccgac      1860
     gccgagcgcg acgccttgct gcgcgcgggc caggaggccg gcaagaagct gccgaaggag      1920
     aacccggtcc agcgctacaa gggtctgggc gagatgaacg ccaaggagct gtgggagacc      1980
     accatggacc cggagcagcg gctgatgctc caggtcacgc tcgacgacgc ggcgcacgcc      2040
     gacgagatct tctcgatcct catgggtgag gacgtcgagc agcgccgctc cttcatccag      2100
     cgcaacgcca aggacgtccg attcctggat atctag                                2136
//

If you have problems or comments...

PBIL Back to PBIL home page