(data stored in ACNUC1104 zone)

EMBL: CP000509.PE60

CP000509.PE60        Location/Qualifiers
FT   CDS_pept        69064..69957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0061"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: oih:OB0776 sugar ABC
FT                   transporter permease; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79610"
FT                   /db_xref="GOA:A1SCS5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCS5"
FT                   /protein_id="ABL79610.1"
FT                   /translation="MTTLTDTERYRRSPAVPHGGDRPRRTGLAITGVAAYLITFTIVLP
FT                   ILWIALLSFQPSDTILSDPFSLNNLTFENYRNAIANLPLAQMYKNTIIVALASVTLGAV
FT                   VSFMASFALTRMVFRHRRAQDSVRFYLLAGLAVPVYVLLFPIYRLDLALGIFGTYAALI
FT                   LPYIAVSIPFNTLLMTGFLRDFPAELEEAAIMDGAGLLRICWSVVLPTMRPVIATILIF
FT                   NVVYVFNEFPFVSILINDPDLATVSLAVSKFQGQYTVDYGGMMAAATLVLLPQLVIYAF
FT                   FQRHVIAGLTAGAVKG"
     atgacgacac tgactgacac cgaacgctac cgacgcagcc ctgcagtacc ccatggcggc        60
     gaccggccgc gacgcaccgg gctggccatc acgggcgtgg ctgcctacct gatcaccttc       120
     accatcgtcc tgccgatcct gtggatcgcc ctgctgtcat tccagcccag cgacacgatc       180
     ctctccgacc cgttctcgct caacaatctg accttcgaga actaccggaa cgcaattgcc       240
     aacctcccgt tggcgcagat gtacaagaac accatcatcg tcgcgctcgc gtccgtcacg       300
     cttggcgccg tcgtgtcctt catggcttcg ttcgcgctca cccgaatggt cttccgccat       360
     aggcgagccc aagactccgt ccggttctac ctgctcgcgg gactcgccgt accggtctac       420
     gtgctgctct tcccgatcta ccggctcgat ctcgcgctgg ggatcttcgg gacctacgcc       480
     gccttgatcc tcccctacat cgcggtgtcc atccccttca acactctcct catgaccggg       540
     ttcctccggg acttcccggc cgagctggag gaggccgcga tcatggacgg tgcggggctc       600
     ctccggatct gctggtcggt ggtgcttccg acgatgaggc ccgtgatcgc cacgatcctg       660
     atcttcaacg tggtctacgt gttcaacgag tttcccttcg tgtcgatcct catcaacgac       720
     cccgaccttg cgacggtgtc gctcgccgta tcgaagttcc aggggcagta caccgtcgac       780
     tacggcggca tgatggcagc ggccacgcta gtgctgcttc cccagctcgt catttatgcc       840
     ttcttccagc gccacgtgat cgcgggcctc acggccggtg ccgtcaaggg ctga             894
//

If you have problems or comments...

PBIL Back to PBIL home page