(data stored in ACNUC1104 zone)

EMBL: CP000509.PE601

CP000509.PE601       Location/Qualifiers
FT   CDS_pept        complement(657099..658139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0619"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: nfa:nfa30730 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80151"
FT                   /db_xref="GOA:A1SEB6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEB6"
FT                   /protein_id="ABL80151.1"
FT                   /translation="MTRAKTRRVSAIAEDPVTPAGVTRVTVGDALRVSHQLALTAATAI
FT                   APMVWGTTYSVTTELLPANRPLFAALMRSLPIGLLAILLTRVLPRRDWWWKAAVLGMLN
FT                   IGSFFPLLFIAAERLPGGVAATLGAAQPLFVTGLAVVMLGERLSLLRLAWGVVGLVGVG
FT                   LVVLGPDVGFDPFGILAGLVGACAMGVGMTLTKRWGRPAGISPISFAAWQLAVGGLALL
FT                   PATLLVEGLPSHVGISSAAGYLWLGAIGGLLAYALWFRGIGRLPVTSAALLGLVSPLVA
FT                   ALMGMLLGERLNSIQVFGFVLALIAVVGGSARVRPIQTDRIQQKATLNLVQPDKVPAEN
FT                   PARFRP"
     atgaccaggg ccaagactcg cagagtgagt gcaattgccg aagaccctgt cacccccgcg        60
     ggggtgacgc gcgtcaccgt aggggacgca ctacgtgtca gccaccaact ggcgttgacc       120
     gccgccacag caatcgcgcc gatggtctgg gggacgacat actccgtcac aaccgaactg       180
     ttgcctgcga accgcccact gttcgcagcg ctgatgcgct ccctcccgat agggctgctg       240
     gcgatactcc tgacccgagt cctgcccagg cgagactggt ggtggaaggc agctgtactc       300
     ggcatgctca acatcgggtc cttctttccg ttgttgttca tcgcagcgga acgactgccg       360
     ggcggggtcg ccgcgaccct gggagccgct cagcctctgt tcgtgactgg gcttgcggtc       420
     gtgatgctcg gcgagcgact gtcactcttg cggcttgcct ggggtgtcgt cggcctggtg       480
     ggtgtgggtc tcgtcgtcct cgggccggat gtcgggttcg acccgttcgg gatcctcgcg       540
     gggctagtcg gcgcatgcgc catgggggtc gggatgacgc tcacgaagcg atggggacgg       600
     ccggccggga tcagtccaat cagcttcgcc gcatggcaac tggccgtagg tgggcttgcc       660
     ctgctgcccg ccacgcttct cgtcgaaggt ctgccctcgc atgtgggcat ctcaagtgca       720
     gcggggtatt tgtggctcgg cgcgatcggc ggcctactcg cctacgcatt gtggtttaga       780
     ggtatcggcc gcctgccggt gacctctgcc gccctactcg gcctggtgtc accgctcgtg       840
     gcagcgctca tggggatgct tctgggagag cgcctcaact cgattcaggt cttcgggttc       900
     gtgctcgctc tcatcgctgt cgtcggcggt tcagctcgag tcaggccgat tcagaccgac       960
     cgtatccagc agaaggcgac actgaacttg gtccaacctg acaaagtgcc cgcagagaat      1020
     ccggctaggt tccgaccatg a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page