(data stored in ACNUC1104 zone)

EMBL: CP000509.PE602

CP000509.PE602       Location/Qualifiers
FT   CDS_pept        658209..659132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0620"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: sma:SAV4790 LysR-family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80152"
FT                   /db_xref="GOA:A1SEB7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEB7"
FT                   /protein_id="ABL80152.1"
FT                   /translation="MRYVLAVADARNFTRAAEQCFVVQSALSQRIANLERELGVALFAR
FT                   TSRRVELTAAGQAFIPPARQCLEAADRAAAEAAAAVGQVRGRLTIGVIPNVAAVDLPDV
FT                   LRRVREKYLAVRIELRVGASDWLAEQVVAGNLDVAFLGLPENQKPVGVSFRALASDRHV
FT                   AVLPVDHHLAGRAEVGLADLSDEAFADFPYGSPGRAQGDYAFASAEIRRDVAYEVVSAD
FT                   LMLDLVRHGLAVALLPSMSVNPMPELAIVSVTDGPGRVEYLAWSDFNPSPATRAFLDIL
FT                   ADEASPGTGHDVHRSALPAIRGSDPT"
     atgcggtacg tcctggcagt cgccgacgcc cggaacttca ccagggccgc ggagcagtgc        60
     ttcgtcgtcc agtcagcact cagccagcgc atcgccaacc ttgagcgcga gctcggcgta       120
     gcgctgttcg cccgcaccag tcgccgtgtc gagctgaccg cggctggcca ggcgttcatc       180
     ccaccagcgc gtcagtgtct tgaggctgcc gaccgggccg cagccgaagc tgctgcggcc       240
     gtagggcaag tgcggggtcg gctcaccatc ggcgtgatcc caaacgtggc agccgtcgac       300
     ctgcccgatg tcctacggcg ggtccgggag aagtaccttg cggttcgcat cgagttgcgg       360
     gtcggcgcaa gtgactggct ggcagaacag gttgtcgcag ggaatctcga tgttgcattt       420
     ctgggcctcc ccgagaacca gaagcccgtc ggcgtgagct tccgcgcatt ggccagcgat       480
     cgccatgttg cggtcctacc ggtcgaccac catctcgcgg ggcgcgccga ggtcggccta       540
     gcggacctgt ccgacgaagc gttcgcggac tttccctacg gttcaccggg ccgcgcccaa       600
     ggagattatg cctttgcctc cgcagagatc cgacgagacg tcgcatacga ggtcgtttcc       660
     gccgacctga tgctggatct cgtcaggcat gggcttgcgg tggcattgct gccatcgatg       720
     tccgtaaacc ccatgcccga gctggccatc gtctcagtta ctgacggccc tggccgcgtc       780
     gagtacctcg cttggagcga cttcaatccc agcccggcga cccgtgcatt tctcgacatt       840
     ctagcggacg aggcaagccc gggaaccggg cacgacgtgc atcgttccgc tttaccagcg       900
     atccgcggat ccgatccgac ctga                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page