(data stored in ACNUC1104 zone)

EMBL: CP000509.PE63

CP000509.PE63        Location/Qualifiers
FT   CDS_pept        72341..73780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0065"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   mmc:Mmcs_5505 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79613"
FT                   /db_xref="GOA:A1SCS8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCS8"
FT                   /protein_id="ABL79613.1"
FT                   /translation="MATKDWSKKTSDAPEGLRRQWRADRALRPAMRSPGRPDPSRVVQR
FT                   QFWRQIATGVTTVEASMAVGVSWPVGARWFRHAGGMPPISLAEPTGRHLTFEEREEIAI
FT                   LRAKDKGVREIARAIGRDPGTVSRELRRNAATRGGKQEYRAGVAQWKAQQAAKRPKTAK
FT                   LVTNERLREYVQDRLAGNVRRPDGTIVPGPTPPPWKGLNKPHRRDRRWSTAWSPEQIAQ
FT                   RLKVEFPDDESMRISHEAIYQSLFIEGRGALKRELVTCLRTGRALREPRARSRNKAQGH
FT                   VTADVVLSERPAEADDRAVPGHWEGDLIIGTGRSAIGTLVERSSRSTLLVHLPRLEGWG
FT                   EKPYVKNGPSLGGYGAVAMNTALTASMTKLPEQLRKTLTWDRGKELSGHALFAVATGTK
FT                   VFFADPHSPWQRPSNENTNGLLRQYFPKGTDLSRWSAEDLEAVAYALNNRPRKVLGWKT
FT                   PAEVFEEQLRSLQQPGVASTS"
     atggcgacga aggactggag caagaagacc agcgatgcgc cggaggggct tcgtcggcag        60
     tggcgtgctg atcgggcgct gaggccggcg atgcgctcgc ccgggcgacc ggacccgtcg       120
     cgggtggtgc agcgacagtt ctggcggcag atcgccacgg gcgtcacgac ggtggaggcg       180
     tcgatggccg tgggcgtgtc gtggccggtc ggtgctcgct ggtttcgcca cgctggcggc       240
     atgccgccga tctcgctggc cgagcccacc ggccgccacc tgaccttcga ggaacgcgag       300
     gagatcgcga tcctgcgcgc caaggacaag ggcgtgcgcg agatagcccg tgcgatcggg       360
     cgtgacccgg ggaccgtctc acgcgaactt cgtcgcaatg cagcgactcg tggcggcaag       420
     caggagtacc gcgctggcgt agcgcagtgg aaggcacagc aggcggcgaa gcgtcccaag       480
     accgcgaagc tcgtgaccaa cgagcggttg cgtgagtacg tgcaggatcg gctcgccggc       540
     aacgtccgcc gtcccgacgg cacgatcgtg ccgggtccga caccgccgcc gtggaagggc       600
     ctgaacaagc cgcatcgccg ggacaggcgg tggtcgacgg cttggagccc ggagcagatc       660
     gcccagcgcc tgaaggtcga gttccccgat gatgagtcca tgcgcatcag ccacgaggcg       720
     atctaccagt cgctgttcat cgagggccgc ggtgcgctca agcgcgaact ggtcacctgt       780
     ctgcgcaccg ggcgtgcgct gcgggagccg cgggcccggt cacggaacaa ggcacagggg       840
     cacgtgaccg ccgatgtcgt tctcagcgag cgccccgctg aggcagacga ccgggccgtc       900
     cctggccact gggagggcga tctgatcatc ggcacgggtc ggtctgcgat cggcaccctc       960
     gtcgagcgca gcagtcgctc aacgctcctg gtccatctgc cgcgactgga gggctggggt      1020
     gagaagccgt acgtcaagaa cgggccatca ctcggtggct acggggccgt cgcgatgaac      1080
     accgcgctga ccgcgtcgat gaccaagctg cccgagcagc tgcgcaagac cctgacgtgg      1140
     gaccgtggca aggaactctc gggccacgcg ttgttcgcgg tggcgaccgg cacgaaggtg      1200
     ttcttcgccg acccgcactc gccgtggcag cgaccgagca acgagaacac caacggcctg      1260
     ttgcgccaat acttccccaa gggcaccgac ctgtcgcgct ggtccgccga ggacctggag      1320
     gccgtcgcct atgcgctcaa caaccggccc cgcaaggtcc tcgggtggaa gacacccgct      1380
     gaggtcttcg aggagcaact acgctccctt caacaacccg gtgttgcatc gaccagttga      1440
//

If you have problems or comments...

PBIL Back to PBIL home page