(data stored in ACNUC1104 zone)

EMBL: CP000509.PE64

CP000509.PE64        Location/Qualifiers
FT   CDS_pept        complement(76344..77522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0068"
FT                   /product="Inulin fructotransferase (DFA-I-forming)"
FT                   /EC_number="4.2.2.17"
FT                   /note="KEGG: ret:RHE_PE00355 putative inulin
FT                   fructotransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79614"
FT                   /db_xref="GOA:A1SCS9"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR040526"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCS9"
FT                   /protein_id="ABL79614.1"
FT                   /translation="MATTVYDVTTWTGATVSPYTDIGLVINQIIADIKSQQNSQTTRPG
FT                   AVIYIPPGHYTLQTTANIDIGFLTIKGSGHGFMSEAIRDDVNHSAWVETLPGSSHVQIA
FT                   NNNQVGFLVNRATDPGTNGRLNSIVFQDFCIDGVSSTKPYIPGNGKIGIKSQYDTDSLR
FT                   IEGMGFVYLNTALTIRNADAFNITNNFIAECGSSIQLTDSSIVGKITNNYLISAWAGNS
FT                   IFIENNEDCVISGNSLLWGARIQMKNVHRAVITGNKFVSNFSGMIVHETPCHEQLISGN
FT                   HFRRKYGDGGPARNDDLFGMVHLNGNDNSVTANHFAFEVPAANIVPSGATPTVVLVKGG
FT                   ARNFLATNKLASNVAVRHVLDASSTATKVLWSGTAAQLQDLSGGNMSFVATP"
     atggcaacaa ccgtttacga cgtcaccacc tggaccggcg ccaccgtctc gccttacacc        60
     gatatcggcc tggtcatcaa ccagatcatc gctgacatca agagccagca gaacagtcag       120
     acgacccgcc ctggcgccgt catctacatt cctcccggtc actacaccct gcagacgaca       180
     gccaacatcg acattggctt cctgacgatc aagggctccg ggcatggctt catgtccgaa       240
     gcaatccgcg acgacgtgaa ccactcggcc tgggtcgaga ctctcccggg ctcaagccat       300
     gtgcagatcg cgaacaacaa ccaggtcggg ttcctcgtca accgggccac cgacccaggg       360
     acgaacggcc gactcaactc gatcgtcttt caggacttct gcatcgacgg cgtcagcagt       420
     accaagccct acattcctgg aaacggaaag atcggcatca agtcgcagta cgacaccgac       480
     tcccttcgaa tcgaggggat gggcttcgtc tacctcaaca cagcactgac catccgcaat       540
     gccgacgcct tcaacatcac caacaacttc atcgctgagt gcggcagctc catccagctg       600
     acagacagct ccatcgtcgg aaagatcacc aacaactacc tgattagcgc gtgggctggg       660
     aactccatct tcatcgagaa caacgaggac tgtgtcatca gcgggaacag tctcctgtgg       720
     ggcgctcgga tccagatgaa gaatgtccat cgcgcagtga ttactggcaa caagttcgtc       780
     agcaacttct ccggaatgat cgttcacgaa actccgtgcc acgagcagct gatctcgggt       840
     aaccacttcc gtcgcaagta cggcgacggt ggccctgccc gcaatgacga tctcttcggc       900
     atggtccatc tcaacggcaa cgacaactcc gtcacagcca atcacttcgc gttcgaggtg       960
     ccggccgcca acatcgtccc ctccggagcc acccccacgg tcgtcctagt caaaggtggg      1020
     gcccgcaact tcctcgccac aaacaagttg gcgtcaaacg tcgcggtacg ccacgtgctc      1080
     gacgcgagtt ccacggccac gaaggttctc tggtcgggca cggcggccca actccaagat      1140
     ctgagcgggg gaaacatgtc cttcgtggca acgccgtga                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page