(data stored in SCRATCH zone)

EMBL: CP000509.PE65

CP000509.PE65        Location/Qualifiers
FT   CDS_pept        complement(79306..79551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79615"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCT0"
FT                   /protein_id="ABL79615.1"
FT                   /translation="MFDIHCNACGKHQLLSISRIRQLVNHEQGIEVIFECWCGTQGAYW
FT                   TGKNARPGDSRTIDSSGVPSAWPCVRGRNTCRATDR"
     gtgttcgaca tccactgcaa cgcctgcggc aagcatcagc tgctgtccat cagccgaatc        60
     aggcagctgg tcaaccacga gcaggggatc gaggtcatct tcgagtgctg gtgcggcacc       120
     caaggcgcgt actggaccgg caagaacgca agaccgggag actcaaggac gatcgactcc       180
     agtggagtcc cgtccgcctg gccttgtgtt cgcggccgca acacgtgtcg cgcaacagac       240
     cgatga                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page