(data stored in ACNUC1104 zone)

EMBL: CP000509.PE67

CP000509.PE67        Location/Qualifiers
FT   CDS_pept        80377..80844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0071"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   rha:RHA1_ro03337 probable leucine-responsive regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79617"
FT                   /db_xref="GOA:A1SCT2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCT2"
FT                   /protein_id="ABL79617.1"
FT                   /translation="MDSLDRAIIDHLRRNAHLTNTELAELVGLTPSPCLRRVRRLENEG
FT                   IILGYHAHIAPVALHRGFEVHVDLELADQTKQTIRVFEAALIAYDEVVEARRMFGAPDY
FT                   QALVAVTDLPAYEHFLTEHLTALPGLGRLQSRFPMKTIKTDTPSTPPTTRH"
     atggattcgc ttgatcgcgc aataatcgac catctgcgcc gcaacgctca tctaacaaac        60
     accgagctgg ctgaactggt cggcttgacg ccatcaccct gcctgcgccg cgtgcgtcga       120
     ctcgagaacg agggcatcat cctcggctac cacgcccaca tcgctccggt agcgcttcac       180
     cgcgggtttg aggtgcatgt cgacctcgag ttagccgacc agacgaagca aacaatccgc       240
     gtcttcgagg ccgctctgat cgcctacgac gaggtcgtgg aagcgcgccg gatgttcggc       300
     gcaccggact accaagccct ggtcgctgtg accgacctgc ctgcctacga gcacttcttg       360
     acagagcacc tcacggccct gccgggcctg ggcagactcc agtcccgctt ccccatgaag       420
     accatcaaga ccgacacacc aagcacgccg cccaccacac gccattga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page