(data stored in SCRATCH zone)

EMBL: CP000509.PE69

CP000509.PE69        Location/Qualifiers
FT   CDS_pept        82532..83164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0073"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   nfa:nfa13110 putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79619"
FT                   /db_xref="GOA:A1SCT4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCT4"
FT                   /protein_id="ABL79619.1"
FT                   /translation="MNGRTPAQSFVSGPLSRAILRLRTQRGLSLSALADQSGVAKGTLS
FT                   NLERGVGNPTLETIFALSRGLGVPIGELVSSEEEAASTFVGRDDARHIRGVAVELMLYD
FT                   RFASTGSATEIYDFRCLPGDRQVSRGHPGVEHIVVKQGRLLTGPTSSPIEVGPGDYVSF
FT                   PSWGDHAYEALDEVVEGFLVIHYPNPAAPSVAIKVESLDSHADRRKP"
     atgaacggaa ggactcccgc tcagtccttc gtgagcggtc ctctgtcgcg ggcgatcctg        60
     cggttgcgca cccagcgcgg cctctccctg agcgccctgg ctgatcagtc gggagtcgcc       120
     aagggcacct tgtcgaatct cgaacgtggc gtggggaacc cgacactcga gaccatcttc       180
     gccctgtcgc ggggcctcgg ggtgccgatc ggtgagctcg tctcgagtga ggaggaggcg       240
     gcgtcgacgt tcgtcggccg cgacgacgcc cgccacatca ggggcgtcgc cgtcgagctg       300
     atgctgtacg accgcttcgc cagcacggga agcgcgaccg agatctacga cttccgttgc       360
     ctgccggggg accggcaggt gtcacgtggg catccgggcg tggagcacat cgtggtcaag       420
     caggggaggt tgctcacggg cccgacctcg tcgccgatcg aggtcgggcc gggtgactac       480
     gtgtcctttc cgtcgtgggg cgatcacgcc tacgaggcgc ttgatgaggt ggtcgaggga       540
     ttcctcgtca tccactatcc gaacccggcg gcaccctctg tcgcgatcaa ggtcgagtcg       600
     ctggactcac acgccgaccg gaggaagccg tga                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page