(data stored in ACNUC1104 zone)

EMBL: CP000509.PE70

CP000509.PE70        Location/Qualifiers
FT   CDS_pept        83161..83565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0074"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0115 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79620"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCT5"
FT                   /protein_id="ABL79620.1"
FT                   /translation="MSGAVPTDPGTAADRAAIRRLLESHLESWNRGDLDALLDTYLQDE
FT                   SVRYASARTVIHGIERVRERFREAYPDRSRLGELRYEGLEIALAGRADAVVFGRARISR
FT                   EGLEDSVSLFSLHLFKRGGQWWIAADHTSA"
     gtgagcggcg cggtgcccac cgacccggga acagcggcag accgagcggc gatccggcga        60
     ctgctggagt cgcatctgga gtcgtggaac cggggggatc tcgacgcgct cctggacacc       120
     tatctccagg acgagtcggt gcgatatgcc tcggcacgca cggtgatcca cgggatcgaa       180
     cgggtccggg aacgtttccg cgaggcctac ccggaccgaa gccggctggg ggagcttcgt       240
     tacgagggcc tcgagatcgc ccttgcagga cgagcggacg cggtcgtctt cgggcgcgcg       300
     cggatctcca gggaaggact cgaggactcc gtgagcctct tctcgctgca tctgttcaag       360
     cgcggcggtc agtggtggat cgcggcggac catacgtcgg cctag                       405
//

If you have problems or comments...

PBIL Back to PBIL home page