(data stored in ACNUC1104 zone)

EMBL: CP000509.PE71

CP000509.PE71        Location/Qualifiers
FT   CDS_pept        83670..84680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0075"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family"
FT                   /note="KEGG: cgb:cg1413 secreted sugar-binding protein; TC
FT                   3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79621"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCT6"
FT                   /protein_id="ABL79621.1"
FT                   /translation="MHKIVRAAAVGVALSSALFLSACSDTAETADAGSTSDESLSIGFF
FT                   GFSKTNSFAQAAFAGISEYAEANDATAEFTDPNFDVQVQLQQLKDALTSKRFDVWIVQA
FT                   NDGVAVQQTIQEAVDAGITVVAEFTPIGPDFETLKPQIPGTLSLVDDPKRNGTVLGELS
FT                   IDACADAGADPCEVAYLQGFSAQPIDVVRTDAFLAAVDRPGVEVVANVEGGYAQDTGRA
FT                   AVQDILQANPDVDVIAGASSAALLGAIELPGIDDVRIVGNGSSTQAVTAVQDGDFYAVY
FT                   VFAEKTAGAKAAEMGLAAARGEEVDPAYVGYDELTPFGVLGTKENLDGYTGEYSD"
     atgcacaaga tcgttcgagc tgccgccgtc ggtgtggccc tcagttccgc cctcttcctc        60
     tcggcgtgca gcgacacggc tgaaaccgca gacgccggat cgacctcgga cgagtcgctg       120
     agcatcgggt tcttcggctt ctcgaagacg aactcgttcg cgcaggcggc cttcgcggga       180
     atcagtgagt acgccgaggc gaacgacgcc accgcggagt tcaccgaccc gaacttcgac       240
     gtgcaggtgc agctccagca gttgaaggac gcgctcacca gcaagcgctt tgacgtctgg       300
     atcgtgcagg cgaacgacgg ggttgccgtt cagcagacga tccaggaggc cgtcgacgcc       360
     ggcatcaccg tcgtcgccga gttcaccccg atcggcccgg acttcgagac cctgaagccg       420
     cagatccccg ggacgctgag tctcgtcgac gacccgaagc ggaacggcac ggtgctcggt       480
     gagctcagca tcgacgcctg tgcggacgcc ggtgcggacc cctgcgaggt cgcgtacctg       540
     cagggcttca gtgcgcagcc catcgacgtg gtgcggaccg acgcgttcct ggcggccgtg       600
     gaccggccgg gcgtcgaggt tgtggccaac gtcgaggggg gttacgccca ggacaccggc       660
     cgcgccgcgg tccaggacat cctccaggcg aacccggacg tggacgtgat cgcaggcgcg       720
     tcctcggctg cgctgctcgg cgcgatcgag cttcccggta tcgatgacgt ccgcatcgtc       780
     ggcaacggca gttcgacgca ggccgtgacc gcagtccagg acggtgactt ctacgccgtg       840
     tacgtgttcg cggagaagac cgctggcgcc aaggcggccg agatgggtct cgccgccgcc       900
     cgcggcgaag aggtcgaccc ggcgtacgtc ggctacgacg agctgacccc gttcggcgta       960
     ctgggcacca aggagaatct cgacggctac accggcgagt actcggactg a               1011
//

If you have problems or comments...

PBIL Back to PBIL home page