(data stored in ACNUC1104 zone)

EMBL: CP000509.PE79

CP000509.PE79        Location/Qualifiers
FT   CDS_pept        94074..94412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0083"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV1733 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79629"
FT                   /db_xref="GOA:A1SCU4"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCU4"
FT                   /protein_id="ABL79629.1"
FT                   /translation="MSAFLRRAADDPIRRRDGKAISIRVDGEQLTGVEGQSIAGVLLAS
FT                   GRLDWRVTSIDGRPRGVFCGIGVCFDCLVTVNDEPDVRACLRRAVHGDVVARQHDPLPT
FT                   PVERGSDD"
     atgagcgcgt tcctccgccg ggcggccgac gacccgatcc gccgccgtga cggcaaggcc        60
     atctccatcc gcgtcgacgg tgagcagctc accggcgtcg aggggcagag catcgccggc       120
     gtcctcctgg caagcggtcg gctcgactgg cgggtcacct cgatcgacgg ccggccgcgc       180
     ggcgtcttct gcggcatcgg cgtctgcttc gactgcctgg tgacggtgaa cgacgagccg       240
     gacgtccgcg cgtgcctgcg acgtgcggtg cacggcgacg tcgtcgcgcg gcaacacgat       300
     cctcttccga ccccggtcga gaggggcagc gatgactga                              339
//

If you have problems or comments...

PBIL Back to PBIL home page