(data stored in ACNUC1104 zone)

EMBL: CP000509.PE8

CP000509.PE8         Location/Qualifiers
FT   CDS_pept        11346..11864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0008"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV4323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79558"
FT                   /db_xref="GOA:A1SCM3"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCM3"
FT                   /protein_id="ABL79558.1"
FT                   /translation="MTDRQDTAVRAPLGERISAKLSNAADEHRANAQPESRQAAAKAAA
FT                   GGRPPRRARLRLTRVDPWSVMKTAFLLAVAFAVVAVVAVFIIWSVLAAAGVWDSINDTV
FT                   RDVVGGEDAANWDVEKYVGLSRVMGFTMLVSVVDVVLITAIATLSAFLYNMSAALVGGV
FT                   ELTLAEDDR"
     atgaccgacc gccaggacac cgccgtacgc gcacctctcg gcgaacgcat ctcggccaag        60
     ctgagcaacg ccgccgacga gcaccgcgcg aacgcgcaac ccgagtcgcg ccaggccgcg       120
     gcgaaggcgg cggccggcgg ccggccgcca cggcgggccc ggctccgcct gacgcgggtc       180
     gacccgtggt cggtgatgaa gaccgccttc ctcctcgcgg tcgcattcgc cgtcgtcgcc       240
     gtcgtcgcgg tcttcatcat ctggtcggtc ctcgcggccg ccggcgtctg ggactcgatc       300
     aacgacaccg tccgcgatgt cgtcggcggc gaggacgcgg cgaactggga cgtcgagaag       360
     tacgtgggcc tgtcccgcgt gatgggcttc acgatgctcg tctcggtggt cgacgtcgtc       420
     ctgatcaccg cgatcgcgac cctcagcgcg ttcctctaca acatgtccgc ggcactcgtc       480
     ggcggggtcg agctgaccct ggccgaggac gaccgctga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page