(data stored in ACNUC1104 zone)

EMBL: CP000509.PE80

CP000509.PE80        Location/Qualifiers
FT   CDS_pept        94405..95871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0084"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; HI0933 family protein; BFD
FT                   domain protein [2Fe-2S]-binding domain protein;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: sco:SCO6291 secreted oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79630"
FT                   /db_xref="GOA:A1SCU5"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR017224"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCU5"
FT                   /protein_id="ABL79630.1"
FT                   /translation="MTDVLVIGAGPAGLAAAAAAREAGGTVTLLDSSDLLGGQYWRHLP
FT                   SSRPAERERLLHHGWDTFAGLRERLASDPHVRIETSAQVWAVERGTGVPVVVHALVGPP
FT                   DAHGRERVALRPDAVVFATGAHDRTLPFPGWDLPGVFTGGAAQALAKGERIAVGRRVLV
FT                   AGAGPFLLPVAASLTQAGAAVVGVLEANRLSTLAKGWSRRPWHLWSTHAKARELAGYAA
FT                   RHLRHGIPYRTGRAVVAAHGTDRVTSVTTMAVDRAWAPVAGTERVIDVDALCVSHGFTP
FT                   RLELAVAAGCSLSPDRFVTTDRDQQTSVPGLYAAGEITGIGGVDLALAEGRIAGWFAAG
FT                   GRIDDRAIDHDLRQRDVYRAFAARLAQAHGIGSGWTRWLEHDTVVCRCEEVSFGRLCGA
FT                   ADATMTTSLRSLKLSSRAALGICQGRVCGRSVEEILGSRATGAPARDGVVADQRPIAAP
FT                   IRIGDLAARQGSPPPHAPPTSPSQTPNETE"
     atgactgacg tcctcgtcat cggagccgga ccggcgggtc tcgcggcggc ggcggccgcg        60
     cgcgaggccg gcggcaccgt caccctcctc gactcctcgg acctgctcgg tggccagtac       120
     tggcgccacc tgcccagctc acgtccggcc gagcgcgagc ggctcctgca ccacggctgg       180
     gacacgttcg ccggtctgcg cgagcgactc gcctcggacc cgcacgtgcg gatcgagacg       240
     tcggcccagg tgtgggcggt cgagcgcggt acgggtgtcc ccgtcgtcgt gcacgcgctg       300
     gtcggtcctc cggacgcgca cgggcgggag cgcgtcgcgc tgcgcccgga tgcggtggtg       360
     ttcgcgaccg gcgcgcacga tcggacgctg ccgttccccg gctgggatct ccccggagtc       420
     ttcaccggag gtgccgcgca ggccctcgcg aagggcgaac ggatcgcggt cggccggcgg       480
     gtgctggtcg ccggggccgg cccgttcctc cttcccgtcg ccgcgtcgct cacccaggcc       540
     ggcgcggcgg tggtgggcgt gctcgaggcg aaccgcctgt cgacgctcgc gaaggggtgg       600
     tcgcggcggc cctggcacct gtggtcgacg cacgcgaagg cacgggagct cgccgggtac       660
     gccgcccgtc acctgcggca cggcatcccc taccggaccg gccgggccgt cgtggctgcc       720
     cacggcaccg atcgggtcac ctcggtgacc acgatggcgg tggaccgcgc ctgggcaccc       780
     gtcgccggca ccgagcgagt gatcgacgtg gacgccctct gcgtgagcca cggcttcacg       840
     ccacggctgg agctcgcggt cgccgccggc tgctcgctga gtccggaccg gttcgtcacg       900
     acggaccgcg accagcagac gagcgtcccc gggctgtacg ccgcagggga gatcaccgga       960
     atcggtgggg tggacctcgc ccttgccgag ggcaggatcg ccggttggtt cgccgcgggc      1020
     gggcggatcg acgaccgggc gatcgaccac gacctccgcc agcgggacgt ctaccgggcg      1080
     ttcgcggcac gtctggcgca ggcacacggg atcggctccg gctggacccg ttggctggag      1140
     cacgacaccg tcgtgtgccg atgcgaggag gtgtcgttcg gtcggctgtg cggcgccgcc      1200
     gacgccacca tgacgacgtc cctgcggtcg ttgaagctct ccagccgggc cgcgctcggc      1260
     atctgccagg gccgggtgtg cgggcgctcg gtcgaggaga tcctcggctc tcgcgcgacg      1320
     ggcgcgccgg ctcgcgacgg ggtcgtcgcc gaccagcgac ccatcgccgc cccgatccgg      1380
     atcggggacc tggccgcacg ccagggctcc ccgccaccac acgccccacc caccagcccg      1440
     tcccagacac cgaacgaaac ggaatga                                          1467
//

If you have problems or comments...

PBIL Back to PBIL home page