(data stored in ACNUC1104 zone)

EMBL: CP000509.PE86

CP000509.PE86        Location/Qualifiers
FT   CDS_pept        complement(102208..102804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0090"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   plu:plu2238 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79636"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCV1"
FT                   /protein_id="ABL79636.1"
FT                   /translation="MEPRHHPAEQLELVGLSPADIRFVVYTHLHHDHAGGGRLFPDAEH
FT                   IAQRTEHRWAHCPDPPAAGGYVATDIAGPRAWRLAEGDWHVFRGFSLIFTPGHTPGHQS
FT                   IMLWDVPDLGNVILAGDAINTHENIDGDLPPGIATDALAASFSMRRLTALADATDAVIV
FT                   AGHDLEQFQAMAKAPERLRRTDRWPGPDRRGVARS"
     atggagccgc ggcaccaccc ggccgagcag ctcgagctcg tgggcctgtc cccggccgac        60
     atcaggttcg tcgtctacac ccacctgcac cacgaccacg cgggcggcgg ccggctgttc       120
     cccgacgccg agcacatcgc ccaacgcacc gagcaccggt gggcacactg cccggatccg       180
     cccgccgccg gcgggtacgt cgcgaccgac atcgccggac cgagggcctg gcgcctggcc       240
     gagggcgact ggcacgtctt ccggggcttc tcgctgatct tcacccccgg ccacaccccc       300
     ggccaccagt cgatcatgct gtgggacgtc cccgacctcg gcaacgtgat cctggccggg       360
     gatgcgatca acacccacga gaacatcgac ggcgacctcc cgcccggcat cgccaccgac       420
     gcgctggcgg cgtcgttctc gatgcgccgc ctcaccgccc tcgccgacgc caccgacgcc       480
     gtcatcgtcg cgggccacga cctggagcag ttccaggcga tggccaaggc acccgagcgg       540
     ctccggagga cagaccggtg gccgggcccg gaccgccggg gcgtcgcccg cagctag          597
//

If you have problems or comments...

PBIL Back to PBIL home page