(data stored in SCRATCH zone)

EMBL: CP000509.PE9

CP000509.PE9         Location/Qualifiers
FT   CDS_pept        12546..13964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0009"
FT                   /product="plasmid pRiA4b ORF-3 family protein"
FT                   /note="PFAM: plasmid pRiA4b ORF-3 family protein; KEGG:
FT                   cef:CE1215 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79559"
FT                   /db_xref="InterPro:IPR012912"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCM4"
FT                   /protein_id="ABL79559.1"
FT                   /translation="MADASPAEVRAVLDALGSGRVSSIFEKLERDQAPTLLTAPAQVRG
FT                   FRVRLDLHGAKPPVWRRLELPGDLSLPRVHAAIQAAMGWTNSHLHRFRTGCDRSSASFV
FT                   TQFDVDEGDEGTLEDDVRLDQLLAENGDELWYEYDFGDGWDHVLVVEEVLEEPPSTVRC
FT                   TGGRSACPPEDCGGLGGYQELAAWVRSGYDDGQLPDVFDDAEDARAWLPLDWHPDEFEV
FT                   EDADAAVAAAAAELVAVSGELAGLAAQLDRHGILLLRQVLSRPSSHGPIEVADAEAGRL
FT                   TETYRTFLEVIGDGVALTAAGHLPPAVVEKFAERSGIADWWIRKANREDATPPVANVRA
FT                   AVRLLGLVSVRKGRLAPTAAAIRCHQDPQALLRHIVERLPVGTQEWEREAGWMALAVAG
FT                   SGVPAEDWRAEISELTFALGWRGDPGDDSLPSPRSRTLRVLDDLGGAARHPWGRNEGVD
FT                   AAVAAVARAVTRRA"
     gtggcggacg ccagtccggc tgaggtgcgc gcggtgctcg atgcgctggg gagtgggcgg        60
     gtgtccagca tcttcgagaa gctcgagcgc gaccaggcac cgaccctgct gacggctccg       120
     gcgcaggtcc gtgggttccg tgtgcggttg gatctgcacg gggccaagcc tccggtgtgg       180
     cggcggctgg agctgcccgg cgacctcagc ctgccgcggg tccatgccgc gatccaggcg       240
     gcaatggggt ggaccaacag ccacctgcac cggttccgga cgggttgtga tcgcagctcg       300
     gcgtcgttcg tcacgcagtt cgacgtcgat gagggtgacg agggcacgct cgaggacgac       360
     gtgcggctcg accagctgct cgccgagaac ggcgacgagc tctggtacga gtacgacttc       420
     ggcgacggct gggatcacgt cttggtggtc gaggaggtgc tcgaggagcc gccttccacc       480
     gtccgctgca cgggaggacg gtcggcctgc ccgcccgagg actgcggcgg tctcggtggc       540
     taccaggagc tggccgcctg ggtccgcagc gggtacgacg acgggcagct ccccgacgtc       600
     ttcgacgatg cggaggacgc ccgcgcctgg ctgccgctcg actggcaccc ggacgaattc       660
     gaggtggagg acgccgacgc cgctgtggcg gccgcggccg ccgagctggt cgcggtcagc       720
     ggcgaactcg ccgggctggc cgcgcagctc gatcggcacg gcatcttgct gttgcggcag       780
     gtgctgagcc gcccctcctc ccacgggccg atcgaggtcg ccgacgccga ggccggccgg       840
     ctgaccgaga cctaccggac cttcctcgag gtgatcggcg acggcgtcgc gctgaccgcc       900
     gccggtcacc tcccgcccgc cgtcgtcgag aagttcgccg agcgcagcgg catcgcggac       960
     tggtggatcc gcaaggccaa ccgtgaggac gccacccccc cggtcgcgaa cgtgcgcgcg      1020
     gcggtccgct tgctcggtct ggtcagcgtt cgcaagggcc ggctcgcgcc gacggcggcc      1080
     gccatccgat gccaccagga cccgcaggcg ctgctgcgcc acatcgtcga acggctcccc      1140
     gtggggaccc aggagtggga gcgcgaggcg ggctggatgg ctctcgcggt ggccggcagc      1200
     ggcgtaccgg ccgaggactg gcgcgccgag atcagcgagc tgacgttcgc tctcgggtgg      1260
     cgcggcgatc ccggtgacga ctcgctgccg tcgccgcgca gcaggacgct gagagtcctc      1320
     gacgatctgg gtggtgcggc gcgccacccg tggggccgca acgagggcgt cgacgccgcg      1380
     gttgcggccg tcgcacgcgc ggtcacccgc cgggcgtga                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page