(data stored in ACNUC1104 zone)

EMBL: CP000509.PE90

CP000509.PE90        Location/Qualifiers
FT   CDS_pept        106207..107760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0095"
FT                   /product="Hydantoinase/oxoprolinase"
FT                   /note="PFAM: Hydantoinase/oxoprolinase;
FT                   Hydantoinaseoxoprolinase domain protein; KEGG: mlo:mll9131
FT                   hydantoinase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79640"
FT                   /db_xref="GOA:A1SCV5"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCV5"
FT                   /protein_id="ABL79640.1"
FT                   /translation="MRIGIDVGGTNTDAVLMDGHQVMGAVKSATQPDVSSGIKATLESL
FT                   RKQRPFAPEDIRAVMIGTTHFINALVEARHLAPTAVLRLGLPATSSLPPLVDWPERLVE
FT                   AIGGRAYLAHGGHEFDGRHIAELDEDELRRHVQDMVAHGLRSLAISSVFSPINSEFELR
FT                   AAEIVAEEAGPEMAVSMSHEIGRVGLLERENATIINAALRELALGIVDGLAGTLASLGI
FT                   DSPLYLSQNDGTLMDMDFARRYPVATFASGPTNSMRGAAILSGLKDCAVVDVGGTTSDV
FT                   GVLTNGFPREATTEVTVAGVRTNFRMPDVLSIGIGGGSLVRGNEAGVTVGPDSVGYRLT
FT                   QEALVLGGSTLTATDIAVASGRADIGDRSLVAHLDRATIEAALARIGSDVADAVERMRT
FT                   SADALPVVAVGGGSILLPDRLEGCGDVHRPEHFSVANAIGAAIAQVGGMVDRIYSIAPG
FT                   QRDAICDEARQEAKDRAVAAGADPETVSIADFDEVPIPYLPGNATRIRCKAVGDLWMER
FT                   "
     atgcgcatcg ggatcgatgt gggaggcacc aacaccgatg ccgtcctgat ggacggtcac        60
     caggtgatgg gagcggtgaa gtcggcgacc cagcccgacg tctcctcggg tatcaaggcg       120
     accctcgaga gcctgcggaa gcagcgtccg ttcgcgccgg aggacatccg ggccgtgatg       180
     atcggcacca cgcacttcat caacgccctc gtcgaggccc ggcacctggc ccccacggcg       240
     gtgctgcggc tggggctgcc cgcgaccagc tcgctgccgc cgctggtcga ctggccggag       300
     cggctggtgg aggccatcgg cgggcgggcg tacctggcgc acggcggcca cgagttcgac       360
     gggcggcaca tcgcggagct cgacgaggac gagctgcgcc ggcacgtcca ggacatggtc       420
     gcgcacggcc tccgctcgct ggcgatctcg tcggtgttct ccccgatcaa ctccgagttc       480
     gagctgcggg ccgccgagat cgtcgccgag gaggcggggc cggagatggc cgtctcgatg       540
     tcccacgaga tcggccgcgt cgggctgctc gagcgcgaga acgccacgat catcaacgcg       600
     gccctgcgcg agctcgcgct gggcatcgtg gacgggctcg ccggcacgct cgcgagcctc       660
     ggcatcgact cgccgctcta cctcagccag aacgacggca cgctgatgga catggacttc       720
     gcgcgccgct acccggtggc gaccttcgcg tccgggccca ccaactccat gcgcggcgcc       780
     gccatcctct ccgggctcaa ggactgcgcc gtcgtcgacg tcggtgggac gacgagcgac       840
     gtcggggtcc tgaccaacgg cttcccgcgc gaggcgacca ccgaggtcac cgtggcgggg       900
     gtgcgcacga acttccggat gccggacgtg ctgagcatcg gcatcggcgg cggcagcctg       960
     gtgcgcggca acgaggccgg cgtgaccgtg gggcccgact ccgtgggcta ccgcctgacc      1020
     caggaggccc tggtcttagg gggcagcacc ctcacggcca ccgacatcgc cgtcgcgtcc      1080
     ggccgcgccg acatcggcga ccgctcactc gtggcgcacc tcgaccgcgc cacgatcgag      1140
     gcggcgctcg cccggatcgg cagcgacgtc gccgacgcgg tcgagcggat gcgcacctcg      1200
     gcggacgccc tgcccgtggt cgccgtcgga ggcggctcga tcctgcttcc cgaccggctg      1260
     gagggctgcg gcgacgtcca ccgtcccgag cacttctccg tcgccaacgc gatcggtgcc      1320
     gcgatcgccc aggtcggcgg catggtcgac cggatctact cgatcgcgcc cgggcagcgc      1380
     gacgcgatct gtgacgaggc ccggcaggag gccaaggacc gcgccgtcgc ggcgggcgcc      1440
     gaccccgaga cggtctcgat cgccgacttc gacgaggtcc cgatccccta cctgcccggc      1500
     aacgccaccc ggatccgctg caaggcggtc ggtgacctct ggatggagcg atga            1554
//

If you have problems or comments...

PBIL Back to PBIL home page