(data stored in ACNUC1104 zone)

EMBL: CP000509.PE91

CP000509.PE91        Location/Qualifiers
FT   CDS_pept        107763..108863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0096"
FT                   /product="protein of unknown function DUF917"
FT                   /note="PFAM: protein of unknown function DUF917; KEGG:
FT                   mlo:mll9130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79641"
FT                   /db_xref="InterPro:IPR010318"
FT                   /db_xref="InterPro:IPR027479"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCV6"
FT                   /protein_id="ABL79641.1"
FT                   /translation="MRVTPTDLIPMARGAAVLGGGGGGDPHIGRLLAASAMRELGDVEI
FT                   VSPEEVPATACVLPIAMMGAPTVMVEKIPSAGQISLALETLARYLGRTPTHVACMEAGG
FT                   VNSMVPFVAAARLGLPLIDGDAMGRAFPELQMVLPTMSGVSATPMSIVDDKNNKGVFDT
FT                   IDNNWAERLARSATIDMGCAPIVSLYAMSGSEVRDCFVPGTLSLCLSIGSAIESARAVN
FT                   QDPVEALVGALRGKLIHTGKVVDVTRRTVAGFARGEAVVTGLDAAAGSQLVLKFQNEHL
FT                   IAEFDGEVLVTTPDLIVVVDAETGEPITTETLRFGHRVAVVAAPMDERWHTPAGIELVG
FT                   PRYFGYDVDPIRFDGTPSEGALLAHV"
     atgcgcgtga ccccgaccga cctgatcccg atggcccgcg gcgcggccgt gctgggcggc        60
     ggcggcggcg gtgaccccca catcgggcgg ctgctcgccg cgagcgccat gcgcgagctc       120
     ggcgacgtcg agatcgtctc ccccgaggag gtgcccgcga ccgcctgcgt gctgcccatc       180
     gcgatgatgg gtgcgccgac ggtgatggtc gagaagatcc cgtcggccgg ccagatctcc       240
     ctggcgctgg agacgctcgc ccgctacctg ggccgcacgc ccacccacgt cgcctgcatg       300
     gaggcgggcg gggtgaactc gatggtgccg ttcgtcgcgg ccgcccgcct ggggctgccg       360
     ctgatcgacg gcgacgccat gggccgcgcc ttcccggagc tccagatggt gctgcccacc       420
     atgtccggcg tctcggcgac cccgatgtcg atcgtcgacg acaagaacaa caagggcgtc       480
     ttcgacacga tcgacaacaa ctgggccgag cggctggcca ggtccgcgac catcgacatg       540
     ggctgcgccc cgatcgtctc gctctacgcg atgtccggga gcgaggtgcg cgactgcttc       600
     gtgcccggca ccctcagcct ctgcctctcg atcggttcgg ccatcgagag cgcgcgggcg       660
     gtcaaccagg acccggtgga ggcgctggtc ggcgccctgc gcgggaagct gatccacacc       720
     gggaaggtcg tcgacgtcac ccgtcgtacc gtcgccgggt tcgcccgcgg ggaggccgtc       780
     gtcaccgggc tggacgccgc cgccgggagc cagctggtcc tgaagtttca gaacgagcac       840
     ctcatcgccg agttcgacgg cgaggtgctc gtcacgacgc cggacctcat cgtcgtcgtc       900
     gacgccgaga ccggtgagcc gatcacgacc gagaccctgc gcttcggcca ccgggtcgcg       960
     gtcgtcgccg ctccgatgga cgagcggtgg cacacgccgg cgggcatcga gctggtcggg      1020
     ccccgctact tcggctacga cgtcgacccg atccggttcg acggcacccc ctcggagggc      1080
     gccctcctag cccacgtctg a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page